| Chain sequence(s) |
A: MIDLATWNLSVPVGNPPYTVETSKLVDGFKDQYFHSNTGTLFFWTPVTGSTTENAKYPRTELRETYSNGTLKNWLYPDADNTLRATLAVNQVPSSGKIVIGQIHAYESQKPLVKLEYQYSTSTKSGILVAKVRMRPDDSEARIITIATGVKLDREFSYLIHLSPRGALGISAAGYQWDTDISKTWSVKPLYFKAGVYVQDHTGYTSEGGQVTFSKLDIDHDK
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| pH calculations | No |
| alphaCutter usage | No |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimization (00:00:02)
[INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:03:53)
[INFO] AutoMutEv:Residue number 187 from chain A and a score of 1.359 (valine) selected for
automated mutation (00:03:54)
[INFO] AutoMutEv:Residue number 143 from chain A and a score of 0.820 (isoleucine) selected
for automated mutation (00:03:54)
[INFO] AutoMutEv:Residue number 204 from chain A and a score of 0.819 (tyrosine) selected
for automated mutation (00:03:54)
[INFO] AutoMutEv:Residue number 144 from chain A and a score of 0.679 (isoleucine) selected
for automated mutation (00:03:54)
[INFO] AutoMutEv:Residue number 145 from chain A and a score of 0.616 (threonine) selected
for automated mutation (00:03:54)
[INFO] AutoMutEv:Residue number 175 from chain A and a score of 0.503 (tyrosine) selected
for automated mutation (00:03:54)
[INFO] AutoMutEv:Mutating residue number 187 from chain A (valine) into threonine (00:03:54)
[INFO] AutoMutEv:Mutating residue number 187 from chain A (valine) into methionine (00:03:54)
[INFO] AutoMutEv:Mutating residue number 143 from chain A (isoleucine) into methionine (00:03:54)
[INFO] AutoMutEv:Mutating residue number 187 from chain A (valine) into alanine (00:04:04)
[INFO] AutoMutEv:Mutating residue number 143 from chain A (isoleucine) into threonine (00:04:17)
[INFO] AutoMutEv:Mutating residue number 204 from chain A (tyrosine) into histidine (00:04:18)
[INFO] AutoMutEv:Mutating residue number 143 from chain A (isoleucine) into leucine (00:04:19)
[INFO] AutoMutEv:Mutating residue number 204 from chain A (tyrosine) into tryptophan (00:04:29)
[INFO] AutoMutEv:Mutating residue number 204 from chain A (tyrosine) into cysteine (00:04:36)
[INFO] AutoMutEv:Mutating residue number 144 from chain A (isoleucine) into methionine (00:04:42)
[INFO] AutoMutEv:Mutating residue number 144 from chain A (isoleucine) into threonine (00:04:43)
[INFO] AutoMutEv:Mutating residue number 145 from chain A (threonine) into glutamic acid (00:04:48)
[INFO] AutoMutEv:Mutating residue number 144 from chain A (isoleucine) into leucine (00:04:52)
[INFO] AutoMutEv:Mutating residue number 145 from chain A (threonine) into lysine (00:04:57)
[INFO] AutoMutEv:Mutating residue number 145 from chain A (threonine) into aspartic acid (00:04:59)
[INFO] AutoMutEv:Mutating residue number 175 from chain A (tyrosine) into cysteine (00:05:06)
[INFO] AutoMutEv:Mutating residue number 175 from chain A (tyrosine) into tryptophan (00:05:16)
[INFO] AutoMutEv:Mutating residue number 175 from chain A (tyrosine) into histidine (00:05:21)
[INFO] AutoMutEv:Effect of mutation residue number 187 from chain A (valine) into threonine:
Energy difference: 0.6309 kcal/mol, Difference in average score from the
base case: -0.0245 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 187 from chain A (valine) into alanine:
Energy difference: -0.0644 kcal/mol, Difference in average score from the
base case: -0.0238 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 187 from chain A (valine) into
methionine: Energy difference: -0.2874 kcal/mol, Difference in average
score from the base case: -0.0183 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 143 from chain A (isoleucine) into
threonine: Energy difference: 1.1903 kcal/mol, Difference in average score
from the base case: -0.0303 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 143 from chain A (isoleucine) into
methionine: Energy difference: 0.4323 kcal/mol, Difference in average score
from the base case: -0.0130 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 143 from chain A (isoleucine) into
leucine: Energy difference: 0.3838 kcal/mol, Difference in average score
from the base case: -0.0065 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 204 from chain A (tyrosine) into
histidine: Energy difference: 0.4289 kcal/mol, Difference in average score
from the base case: -0.0371 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 204 from chain A (tyrosine) into
cysteine: Energy difference: 0.2307 kcal/mol, Difference in average score
from the base case: -0.0142 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 204 from chain A (tyrosine) into
tryptophan: Energy difference: 0.1625 kcal/mol, Difference in average score
from the base case: -0.0028 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 144 from chain A (isoleucine) into
threonine: Energy difference: 2.7726 kcal/mol, Difference in average score
from the base case: 0.0051 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 144 from chain A (isoleucine) into
methionine: Energy difference: 2.2728 kcal/mol, Difference in average score
from the base case: -0.0004 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 144 from chain A (isoleucine) into
leucine: Energy difference: 1.2526 kcal/mol, Difference in average score
from the base case: 0.0012 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 145 from chain A (threonine) into
glutamic acid: Energy difference: -0.0337 kcal/mol, Difference in average
score from the base case: -0.0228 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 145 from chain A (threonine) into
aspartic acid: Energy difference: 0.7567 kcal/mol, Difference in average
score from the base case: -0.0195 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 145 from chain A (threonine) into lysine:
Energy difference: -0.4888 kcal/mol, Difference in average score from the
base case: -0.0225 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 175 from chain A (tyrosine) into
histidine: Energy difference: 0.4430 kcal/mol, Difference in average score
from the base case: -0.0322 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 175 from chain A (tyrosine) into
cysteine: Energy difference: 0.2835 kcal/mol, Difference in average score
from the base case: -0.0118 (00:05:34)
[INFO] AutoMutEv:Effect of mutation residue number 175 from chain A (tyrosine) into
tryptophan: Energy difference: 0.5151 kcal/mol, Difference in average score
from the base case: -0.0017 (00:05:34)
[INFO] Main: Simulation completed successfully. (00:05:40)
|
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan4D score | mutation |
|---|---|---|---|---|
| 1 | M | A | 0.0482 | |
| 2 | I | A | 0.0000 | |
| 3 | D | A | -1.7147 | |
| 4 | L | A | 0.0000 | |
| 5 | A | A | -0.7743 | |
| 6 | T | A | -0.3690 | |
| 7 | W | A | 0.0000 | |
| 8 | N | A | -0.7913 | |
| 9 | L | A | 0.0000 | |
| 10 | S | A | 0.0000 | |
| 11 | V | A | 0.0000 | |
| 12 | P | A | 0.0000 | |
| 13 | V | A | 0.3206 | |
| 14 | G | A | -0.6227 | |
| 15 | N | A | -1.6229 | |
| 16 | P | A | -1.2368 | |
| 17 | P | A | -0.4438 | |
| 18 | Y | A | 0.2527 | |
| 19 | T | A | -0.2575 | |
| 20 | V | A | 0.0000 | |
| 21 | E | A | -2.2177 | |
| 22 | T | A | 0.0000 | |
| 23 | S | A | -1.5924 | |
| 24 | K | A | -2.3544 | |
| 25 | L | A | 0.0000 | |
| 26 | V | A | -0.1627 | |
| 27 | D | A | -1.6896 | |
| 28 | G | A | -1.3822 | |
| 29 | F | A | -1.7861 | |
| 30 | K | A | -2.8228 | |
| 31 | D | A | -2.0850 | |
| 32 | Q | A | -1.8277 | |
| 33 | Y | A | -0.8977 | |
| 34 | F | A | 0.0000 | |
| 35 | H | A | -1.5395 | |
| 36 | S | A | -1.0500 | |
| 37 | N | A | -1.6164 | |
| 38 | T | A | -0.7711 | |
| 39 | G | A | -0.7603 | |
| 40 | T | A | -0.6289 | |
| 41 | L | A | 0.0000 | |
| 42 | F | A | -0.3929 | |
| 43 | F | A | 0.0000 | |
| 44 | W | A | -0.3589 | |
| 45 | T | A | 0.0000 | |
| 46 | P | A | 0.0000 | |
| 47 | V | A | 0.0000 | |
| 48 | T | A | -0.0443 | |
| 49 | G | A | 0.0000 | |
| 50 | S | A | -0.6645 | |
| 51 | T | A | -1.3502 | |
| 52 | T | A | -1.9146 | |
| 53 | E | A | -2.9459 | |
| 54 | N | A | -2.7651 | |
| 55 | A | A | -2.1459 | |
| 56 | K | A | -2.2871 | |
| 57 | Y | A | -1.0008 | |
| 58 | P | A | 0.0000 | |
| 59 | R | A | -0.1323 | |
| 60 | T | A | 0.0000 | |
| 61 | E | A | 0.0000 | |
| 62 | L | A | 0.0000 | |
| 63 | R | A | -0.2486 | |
| 64 | E | A | 0.0000 | |
| 65 | T | A | 0.0000 | |
| 66 | Y | A | 0.2596 | |
| 67 | S | A | -0.2961 | |
| 68 | N | A | -1.3498 | |
| 69 | G | A | -1.0956 | |
| 70 | T | A | -0.3166 | |
| 71 | L | A | 0.3967 | |
| 72 | K | A | -0.0424 | |
| 73 | N | A | -0.0628 | |
| 74 | W | A | 0.0000 | |
| 75 | L | A | 0.2236 | |
| 76 | Y | A | 0.0000 | |
| 77 | P | A | -1.5585 | |
| 78 | D | A | -2.6846 | |
| 79 | A | A | 0.0000 | |
| 80 | D | A | -2.6481 | |
| 81 | N | A | 0.0000 | |
| 82 | T | A | 0.0000 | |
| 83 | L | A | 0.0000 | |
| 84 | R | A | -1.6196 | |
| 85 | A | A | 0.0000 | |
| 86 | T | A | -1.4760 | |
| 87 | L | A | 0.0000 | |
| 88 | A | A | 0.0000 | |
| 89 | V | A | 0.0000 | |
| 90 | N | A | -1.8819 | |
| 91 | Q | A | -1.4156 | |
| 92 | V | A | -0.5420 | |
| 93 | P | A | 0.0000 | |
| 94 | S | A | -0.5843 | |
| 95 | S | A | -0.4089 | |
| 96 | G | A | 0.0000 | |
| 97 | K | A | -0.6274 | |
| 98 | I | A | 0.0000 | |
| 99 | V | A | 0.0000 | |
| 100 | I | A | 0.0000 | |
| 101 | G | A | 0.0000 | |
| 102 | Q | A | 0.0000 | |
| 103 | I | A | 0.0000 | |
| 104 | H | A | -0.7452 | |
| 105 | A | A | 0.0000 | |
| 106 | Y | A | -0.8887 | |
| 107 | E | A | -2.0777 | |
| 108 | S | A | -1.8864 | |
| 109 | Q | A | -2.2230 | |
| 110 | K | A | -2.4528 | |
| 111 | P | A | 0.0000 | |
| 112 | L | A | 0.0000 | |
| 113 | V | A | 0.0000 | |
| 114 | K | A | -0.2788 | |
| 115 | L | A | 0.0000 | |
| 116 | E | A | 0.0000 | |
| 117 | Y | A | 0.0000 | |
| 118 | Q | A | -0.1698 | |
| 119 | Y | A | -0.6754 | |
| 120 | S | A | -0.8551 | |
| 121 | T | A | -0.8458 | |
| 122 | S | A | -0.8016 | |
| 123 | T | A | -1.2084 | |
| 124 | K | A | -2.0981 | |
| 125 | S | A | 0.0000 | |
| 126 | G | A | 0.0000 | |
| 127 | I | A | 0.1817 | |
| 128 | L | A | 0.0000 | |
| 129 | V | A | 0.0000 | |
| 130 | A | A | 0.0000 | |
| 131 | K | A | -0.4203 | |
| 132 | V | A | 0.0000 | |
| 133 | R | A | -1.9164 | |
| 134 | M | A | -2.0937 | |
| 135 | R | A | -2.7361 | |
| 136 | P | A | 0.0000 | |
| 137 | D | A | -2.8803 | |
| 138 | D | A | -2.7651 | |
| 139 | S | A | -2.0748 | |
| 140 | E | A | -2.7910 | |
| 141 | A | A | -1.8451 | |
| 142 | R | A | -1.4141 | |
| 143 | I | A | 0.8195 | |
| 144 | I | A | 0.6794 | |
| 145 | T | A | 0.6161 | |
| 146 | I | A | 0.0000 | |
| 147 | A | A | 0.0000 | |
| 148 | T | A | 0.0069 | |
| 149 | G | A | -0.7798 | |
| 150 | V | A | 0.0000 | |
| 151 | K | A | -2.8262 | |
| 152 | L | A | -2.6078 | |
| 153 | D | A | -3.5303 | |
| 154 | R | A | -3.9340 | |
| 155 | E | A | -3.3541 | |
| 156 | F | A | 0.0000 | |
| 157 | S | A | -0.8138 | |
| 158 | Y | A | 0.0000 | |
| 159 | L | A | -0.2571 | |
| 160 | I | A | 0.0000 | |
| 161 | H | A | -0.6680 | |
| 162 | L | A | 0.0000 | |
| 163 | S | A | -1.6426 | |
| 164 | P | A | -2.0177 | |
| 165 | R | A | -2.7297 | |
| 166 | G | A | 0.0000 | |
| 167 | A | A | -1.7692 | |
| 168 | L | A | 0.0000 | |
| 169 | G | A | -1.2380 | |
| 170 | I | A | 0.0000 | |
| 171 | S | A | -0.4812 | |
| 172 | A | A | 0.0000 | |
| 173 | A | A | -0.2373 | |
| 174 | G | A | -0.1314 | |
| 175 | Y | A | 0.5032 | |
| 176 | Q | A | -0.9465 | |
| 177 | W | A | -0.9822 | |
| 178 | D | A | -2.3770 | |
| 179 | T | A | -1.7023 | |
| 180 | D | A | -2.6633 | |
| 181 | I | A | 0.0000 | |
| 182 | S | A | -1.9239 | |
| 183 | K | A | -2.2752 | |
| 184 | T | A | -1.1180 | |
| 185 | W | A | 0.0000 | |
| 186 | S | A | -0.2636 | |
| 187 | V | A | 1.3593 | |
| 188 | K | A | 0.1367 | |
| 189 | P | A | 0.0253 | |
| 190 | L | A | 0.0000 | |
| 191 | Y | A | 0.0133 | |
| 192 | F | A | 0.0000 | |
| 193 | K | A | -0.2510 | |
| 194 | A | A | 0.0000 | |
| 195 | G | A | 0.0000 | |
| 196 | V | A | 0.0000 | |
| 197 | Y | A | -0.0723 | |
| 198 | V | A | 0.0000 | |
| 199 | Q | A | 0.0000 | |
| 200 | D | A | 0.0000 | |
| 201 | H | A | -0.8643 | |
| 202 | T | A | -0.3608 | |
| 203 | G | A | -0.1420 | |
| 204 | Y | A | 0.8187 | |
| 205 | T | A | 0.2519 | |
| 206 | S | A | -0.0138 | |
| 207 | E | A | -0.2839 | |
| 208 | G | A | 0.0000 | |
| 209 | G | A | 0.0000 | |
| 210 | Q | A | -0.5201 | |
| 211 | V | A | 0.0000 | |
| 212 | T | A | -0.7874 | |
| 213 | F | A | 0.0000 | |
| 214 | S | A | -1.0660 | |
| 215 | K | A | -2.3790 | |
| 216 | L | A | 0.0000 | |
| 217 | D | A | -2.6711 | |
| 218 | I | A | -1.6189 | |
| 219 | D | A | -2.2191 | |
| 220 | H | A | -2.4259 | |
| 221 | D | A | -3.4390 | |
| 222 | K | A | -3.2913 |
Automated mutations analysis - evolutionary conserved mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated based off an evolutionary approach.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
| TK145A | -0.4888 | -0.0225 | View | CSV | PDB |
| VM187A | -0.2874 | -0.0183 | View | CSV | PDB |
| VA187A | -0.0644 | -0.0238 | View | CSV | PDB |
| TE145A | -0.0337 | -0.0228 | View | CSV | PDB |
| YH204A | 0.4289 | -0.0371 | View | CSV | PDB |
| YH175A | 0.443 | -0.0322 | View | CSV | PDB |
| YC204A | 0.2307 | -0.0142 | View | CSV | PDB |
| YC175A | 0.2835 | -0.0118 | View | CSV | PDB |
| IM143A | 0.4323 | -0.013 | View | CSV | PDB |
| IT143A | 1.1903 | -0.0303 | View | CSV | PDB |
| IM144A | 2.2728 | -0.0004 | View | CSV | PDB |
| IL144A | 1.2526 | 0.0012 | View | CSV | PDB |