Project name: AlaAla_R4

Status: done

Started: 2026-08-20 08:52:29
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:34)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1b1520119518425/tmp/folded.pdb                (00:01:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:39)
Show buried residues

Minimal score value
-2.6203
Maximal score value
2.0534
Average score
-0.5317
Total score value
-131.8606

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6920
2 V A 0.0000
3 Q A -2.0491
4 L A 0.0000
5 Q A -1.8584
6 E A 0.0000
7 S A -0.7009
8 G A -0.4072
9 P A -0.0315
10 G A 0.2754
11 L A 0.7825
12 V A 0.0000
13 K A -1.6843
14 P A -1.2655
15 S A -1.3518
16 Q A -1.8559
17 T A -1.5441
18 L A 0.0000
19 S A -1.0060
20 L A 0.0000
21 T A -0.7012
22 A A 0.0000
23 T A -1.2498
24 V A 0.0000
25 S A -1.3939
26 G A -1.4241
27 G A -1.0970
28 S A -0.6525
29 I A 0.0000
30 S A -0.2816
31 S A -0.3308
32 G A -0.0741
33 D A 0.0844
34 Y A 0.6122
35 Y A 0.5062
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.7218
43 P A -0.7087
44 G A -1.1365
45 C A -1.2645
46 K A -2.0687
47 G A -1.2388
48 L A 0.0000
49 E A -0.7208
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1289
54 I A 0.0000
55 Y A 0.2720
56 Y A 0.2439
57 S A -0.1236
58 G A -0.2261
59 S A -0.2354
60 T A -0.2078
61 D A -0.6056
62 Y A -0.7350
63 N A -0.9611
64 P A -1.3028
65 S A -1.2051
66 L A 0.0000
67 K A -2.1183
68 S A -1.4139
69 R A -1.6291
70 V A 0.0000
71 T A -1.1020
72 M A 0.0000
73 S A -0.4148
74 V A -0.3892
75 D A -1.2147
76 T A -1.0387
77 S A -1.3342
78 K A -2.1768
79 N A -1.4640
80 Q A -1.2858
81 F A 0.0000
82 S A -0.5831
83 L A 0.0000
84 K A -1.6539
85 V A 0.0000
86 N A -1.6561
87 S A -1.4618
88 V A 0.0000
89 T A -0.6379
90 A A -0.3937
91 A A -0.3069
92 D A 0.0000
93 T A 0.2721
94 A A 0.0000
95 V A 0.2401
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.0000
103 I A 1.6818
104 F A 2.0534
105 G A 0.8443
106 V A 0.8641
107 G A 0.8574
108 T A 0.0000
109 F A 0.0000
110 D A -0.5145
111 Y A -0.5644
112 W A -0.8350
113 G A 0.0000
114 Q A -1.6419
115 G A -0.7565
116 T A -0.1768
117 L A 0.8362
118 V A 0.0000
119 T A 0.3052
120 V A 0.0000
121 S A -0.3399
122 S A -0.7391
123 A A -0.6025
124 A A -0.3616
125 G A -0.8439
126 G A -1.0924
127 G A -1.1561
128 G A -1.1979
129 S A -1.0269
130 G A -1.1757
131 G A -1.2188
132 G A -1.4137
133 G A -1.2366
134 S A -0.9579
135 G A -1.3040
136 G A -1.1011
137 G A -1.2594
138 G A -0.8684
139 S A -0.7194
140 D A -0.5853
141 I A 0.0054
142 V A 0.9007
143 M A 0.0000
144 T A -0.6468
145 Q A -0.7365
146 S A -0.7812
147 P A -0.3622
148 A A -0.3477
149 T A -0.4227
150 L A -0.1575
151 S A -0.3205
152 L A -0.6305
153 S A -0.9285
154 P A -1.4117
155 G A -1.7188
156 E A -2.2873
157 R A -2.6203
158 A A 0.0000
159 T A -0.6546
160 L A 0.0000
161 S A -0.9303
162 A A 0.0000
163 R A -2.3923
164 A A 0.0000
165 S A -0.8283
166 Q A -1.5190
167 S A -1.2078
168 V A 0.0000
169 S A -0.4097
170 S A -0.1252
171 Y A 0.8589
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4122
179 P A -0.9291
180 G A -0.9981
181 C A -1.1287
182 Q A -1.5885
183 A A -1.1980
184 P A 0.0000
185 R A -1.5401
186 L A -0.7110
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2377
190 D A -0.3541
191 A A 0.0000
192 S A -0.9128
193 N A -1.2739
194 R A -1.4438
195 A A -0.9691
196 T A -0.6528
197 G A -0.6615
198 I A 0.0000
199 P A -0.4469
200 A A -0.3833
201 R A -0.7011
202 F A 0.0000
203 S A -0.6864
204 G A -0.7147
205 S A -0.8264
206 G A -1.1704
207 S A -0.9451
208 G A -1.0553
209 T A -1.7841
210 D A -2.2152
211 F A 0.0000
212 T A -0.8125
213 L A 0.0000
214 T A -0.5906
215 I A 0.0000
216 S A -1.3021
217 S A -1.6510
218 L A 0.0000
219 E A -2.1081
220 P A -1.4005
221 E A -2.2556
222 D A 0.0000
223 F A -0.6180
224 A A 0.0000
225 V A -0.5253
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3543
232 G A 0.0828
233 S A -0.1188
234 T A -0.2954
235 P A -0.1691
236 L A 0.0000
237 T A 0.2752
238 F A 0.2582
239 G A 0.0000
240 G A -0.8117
241 G A -0.7537
242 T A 0.0000
243 K A -0.7418
244 A A 0.0000
245 E A -0.3654
246 I A 0.7417
247 K A -0.8736
248 A A -0.3464
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4978 5.0481 View CSV PDB
4.5 -0.516 5.0436 View CSV PDB
5.0 -0.5366 5.0318 View CSV PDB
5.5 -0.5548 5.0071 View CSV PDB
6.0 -0.5645 4.9691 View CSV PDB
6.5 -0.5613 4.9228 View CSV PDB
7.0 -0.5458 4.8729 View CSV PDB
7.5 -0.522 4.8219 View CSV PDB
8.0 -0.4936 4.7706 View CSV PDB
8.5 -0.4618 4.7192 View CSV PDB
9.0 -0.4277 4.6682 View CSV PDB