Project name: 1b4ed6551d3dee6

Status: done

Started: 2026-03-10 18:51:46
Chain sequence(s) A: MHHHHHHFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTGGGGSDDRFNDVNTINKKQFTEEEFSRLINSMLKEYIEDNKKDKHPTQKTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKTSDTHTIKRTTPKPTTPKQINDGTSDKPKSIADIFLINKPKVPLWIVNPLYYMVEKFVQIMGYLLEDDDTLELNLPKYYYDKSI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:37)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1b4ed6551d3dee6/tmp/folded.pdb                (00:05:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:42)
Show buried residues

Minimal score value
-5.4378
Maximal score value
3.7211
Average score
-0.8691
Total score value
-278.9853

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1723
2 H A -1.3771
3 H A -2.1072
4 H A -2.5529
5 H A -2.6424
6 H A -2.6266
7 H A -2.2935
8 F A -1.8349
9 D A -2.9589
10 A A -2.3047
11 S A -2.3733
12 N A -2.5907
13 F A 0.0000
14 K A -2.5030
15 D A -1.3401
16 F A -0.4685
17 S A -0.6898
18 S A -1.2664
19 I A 0.0000
20 A A -0.4707
21 S A -0.8941
22 A A -1.0531
23 S A -0.6981
24 S A 0.0000
25 S A -0.2191
26 W A 0.0000
27 Q A -0.9877
28 N A 0.0000
29 Q A -1.7251
30 S A -1.1814
31 G A -0.9959
32 S A 0.0000
33 T A -0.6960
34 M A 0.0000
35 I A -0.2137
36 I A 0.0000
37 Q A -1.5922
38 V A 0.0000
39 D A -0.7532
40 S A 0.3433
41 F A 1.1186
42 G A 0.0000
43 N A -0.9865
44 V A 0.0000
45 S A -1.1871
46 G A -0.8865
47 Q A -0.9935
48 Y A 0.0000
49 V A 0.0000
50 N A 0.0000
51 R A -1.8540
52 A A -1.5675
53 Q A -1.7973
54 G A -1.3399
55 T A -1.0989
56 G A -1.5091
57 C A 0.0000
58 Q A -2.1229
59 N A -1.9076
60 S A -1.4386
61 P A -1.2377
62 Y A 0.0000
63 P A -0.8956
64 L A 0.0000
65 T A -0.9624
66 G A -1.1674
67 R A -1.8787
68 V A 0.0000
69 N A -1.0095
70 G A -0.5895
71 T A -0.0543
72 F A 1.0522
73 I A 0.0000
74 A A -0.3846
75 F A 0.0000
76 S A -0.5930
77 V A 0.0000
78 G A -1.0495
79 W A 0.0000
80 N A -2.5331
81 N A -1.6839
82 S A -1.1701
83 T A -1.2676
84 E A -2.4808
85 N A -2.5632
86 C A -1.7843
87 N A -2.1929
88 S A -0.9534
89 A A -0.4305
90 T A 0.0000
91 G A -0.4890
92 W A 0.0000
93 T A 0.0110
94 G A 0.0000
95 Y A 1.1254
96 A A 0.0000
97 Q A -1.1470
98 V A -1.6109
99 N A -2.0501
100 G A -1.8300
101 N A -2.3865
102 N A -2.1515
103 T A 0.0000
104 E A -1.0928
105 I A 0.0000
106 V A 0.2462
107 T A 0.0000
108 S A -0.8161
109 W A -0.9165
110 N A -0.9357
111 L A -0.2379
112 A A -0.0256
113 Y A -0.5022
114 E A -1.8390
115 G A -1.1338
116 G A -1.0594
117 S A -0.8858
118 G A -1.0162
119 P A -0.7744
120 A A -0.0377
121 I A 0.9423
122 E A -0.7340
123 Q A -1.7237
124 G A -1.6755
125 Q A -1.7313
126 D A -1.1167
127 T A -0.7757
128 F A 0.0000
129 Q A -1.2320
130 Y A 0.0000
131 V A 0.1559
132 P A -0.5860
133 T A -0.8116
134 T A -1.5589
135 E A -3.0466
136 N A -2.8447
137 K A -2.3462
138 S A -0.9141
139 L A 0.8246
140 L A 0.6892
141 K A -1.5110
142 D A -2.2791
143 T A -1.6892
144 G A -1.6164
145 G A -1.3714
146 G A -1.2491
147 G A -1.5286
148 S A -1.7350
149 D A -2.5602
150 D A -3.3635
151 R A -2.7761
152 F A -0.7225
153 N A -2.2437
154 D A -1.7557
155 V A 0.4881
156 N A -0.8635
157 T A -0.5144
158 I A 0.4049
159 N A -1.8850
160 K A -2.8532
161 K A -2.6849
162 Q A -1.9748
163 F A 0.2855
164 T A -0.9693
165 E A -2.0481
166 E A -2.3160
167 E A -1.0045
168 F A 0.6818
169 S A -0.9170
170 R A -1.8339
171 L A -0.0256
172 I A 0.1172
173 N A -1.1328
174 S A -0.6550
175 M A -0.0943
176 L A 0.1278
177 K A -1.8292
178 E A -2.4749
179 Y A -0.5262
180 I A -0.7116
181 E A -3.8026
182 D A -4.5828
183 N A -4.5983
184 K A -5.1244
185 K A -5.3481
186 D A -5.4378
187 K A -4.8038
188 H A -3.5096
189 P A -1.9967
190 T A -1.7691
191 Q A -2.2801
192 K A -2.4363
193 T A -1.5301
194 T A -1.2980
195 P A -1.4334
196 K A -1.9992
197 P A -1.2338
198 T A -0.9560
199 T A -1.0252
200 P A -1.2281
201 K A -2.0490
202 Q A -1.6537
203 I A -0.1852
204 N A -1.7875
205 D A -2.3178
206 G A -1.7296
207 T A -1.6209
208 S A -1.8811
209 D A -2.8372
210 K A -2.9172
211 T A -1.9744
212 S A -1.8637
213 D A -2.4008
214 T A -1.2726
215 H A -1.2108
216 T A -0.4848
217 I A 0.3495
218 K A -1.7840
219 R A -2.2258
220 T A -1.4749
221 T A -1.3527
222 P A -1.4219
223 K A -1.9988
224 P A -1.2326
225 T A -0.9757
226 T A -1.0407
227 P A -1.2251
228 K A -2.0520
229 Q A -1.6598
230 I A -0.1918
231 N A -1.8096
232 D A -2.3189
233 G A -1.7046
234 T A -1.6683
235 S A -1.9116
236 D A -2.8348
237 K A -2.9216
238 T A -1.9373
239 S A -1.8865
240 D A -2.3884
241 T A -1.2769
242 H A -1.1827
243 T A -0.4218
244 I A 0.3763
245 K A -1.7771
246 R A -2.2452
247 T A -1.4514
248 T A -1.3268
249 P A -1.4390
250 K A -1.9986
251 P A -1.2433
252 T A -0.9869
253 T A -1.0430
254 P A -1.1954
255 K A -2.0351
256 Q A -1.7099
257 I A -0.2884
258 N A -1.8323
259 D A -2.3037
260 G A -1.7247
261 T A -1.8835
262 S A -2.0694
263 D A -3.0763
264 K A -3.1595
265 P A -1.8537
266 K A -2.1377
267 S A -0.0559
268 I A 2.2605
269 A A 2.1628
270 D A 1.2325
271 I A 2.5959
272 F A 3.7211
273 L A 3.3276
274 I A 2.4160
275 N A -0.3943
276 K A -1.2427
277 P A -1.5096
278 K A -2.0209
279 V A 0.5224
280 P A 1.4094
281 L A 2.7883
282 W A 3.6382
283 I A 3.6153
284 V A 3.4614
285 N A 2.6673
286 P A 2.6121
287 L A 2.7821
288 Y A 3.1349
289 Y A 3.2970
290 M A 2.9163
291 V A 3.3355
292 E A 1.8418
293 K A 1.2630
294 F A 3.0550
295 V A 2.3252
296 Q A 1.4382
297 I A 2.6458
298 M A 2.4100
299 G A 1.8428
300 Y A 2.6245
301 L A 2.4708
302 L A 1.6615
303 E A -0.4785
304 D A -2.6816
305 D A -3.1986
306 D A -3.0125
307 T A -1.5763
308 L A -0.1885
309 E A -0.4771
310 L A 0.7959
311 N A -0.3264
312 L A 0.9815
313 P A 0.6516
314 K A -0.4787
315 Y A 0.9193
316 Y A 1.4682
317 Y A 0.8863
318 D A -1.1281
319 K A -1.3870
320 S A 0.0434
321 I A 1.4298
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3735 7.4046 View CSV PDB
4.5 -0.4648 7.3972 View CSV PDB
5.0 -0.5673 7.3879 View CSV PDB
5.5 -0.6574 7.3783 View CSV PDB
6.0 -0.7112 7.3697 View CSV PDB
6.5 -0.7183 7.3637 View CSV PDB
7.0 -0.6899 7.3605 View CSV PDB
7.5 -0.6442 7.3592 View CSV PDB
8.0 -0.5896 7.3587 View CSV PDB
8.5 -0.5247 7.3583 View CSV PDB
9.0 -0.4451 7.3573 View CSV PDB