Project name: 57 03 48 01 FINAL ANTIBODY

Status: done

Started: 2026-03-17 07:27:49
Chain sequence(s) A: NFMLTQPHSVSESPGKTVTISCKRSTGNIGSNYVNWYQQRPGSAPTTVIYRDDGRPDGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCHSHSGGINVFGGGTKLTVLGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYLMAWVRQAPGKGLEWVSTISSSGSRIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHLRDGGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:03)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:17)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:18)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:18)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:38)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1b5fd1acfccaa5a/tmp/folded.pdb                (00:04:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:21)
Show buried residues

Minimal score value
-3.0286
Maximal score value
1.6534
Average score
-0.7388
Total score value
-179.5216

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 N A -1.0835
2 F A 0.0000
3 M A 0.2967
4 L A 0.0000
5 T A -0.8208
6 Q A -1.2303
7 P A -1.1928
8 H A -1.6580
9 S A -1.3553
10 V A -0.7071
11 S A -0.4708
12 E A -0.8802
13 S A -0.8368
14 P A -1.4427
15 G A -1.6749
16 K A -2.1100
17 T A -1.1225
18 V A 0.0000
19 T A -0.1478
20 I A 0.0000
21 S A -0.7787
22 C A 0.0000
23 K A -2.1556
24 R A -1.3772
25 S A -0.8877
26 T A -0.9951
27 G A -1.4275
28 N A -2.2808
29 I A 0.0000
30 G A -1.1256
31 S A -0.8988
32 N A -0.6933
33 Y A -0.1603
34 V A 0.0000
35 N A 0.0000
36 W A 0.0000
37 Y A 0.0000
38 Q A 0.0000
39 Q A 0.0000
40 R A -2.1078
41 P A -1.2008
42 G A -1.0305
43 S A -1.0389
44 A A -0.6481
45 P A 0.0000
46 T A -0.1618
47 T A 0.0000
48 V A 0.0000
49 I A 0.0000
50 Y A -0.9210
51 R A -1.5829
52 D A -1.4843
53 D A -2.3073
54 G A -1.8518
55 R A -2.0967
56 P A -1.6985
57 D A -2.1615
58 G A -1.7164
59 V A -1.2942
60 P A -1.5311
61 D A -2.1854
62 R A -1.3077
63 F A 0.0000
64 S A -1.3398
65 G A -1.2105
66 S A -1.0187
67 I A -0.5753
68 D A -1.5589
69 S A -1.4610
70 S A -0.9080
71 S A -1.2283
72 N A -1.7779
73 S A 0.0000
74 A A 0.0000
75 S A -0.7472
76 L A 0.0000
77 T A -0.2464
78 I A 0.0000
79 S A -1.2532
80 G A -1.2995
81 L A 0.0000
82 K A -2.3015
83 T A -2.0857
84 E A -3.0286
85 D A 0.0000
86 E A -2.4371
87 A A 0.0000
88 D A -1.6768
89 Y A 0.0000
90 Y A 0.0000
91 C A 0.0000
92 H A 0.0000
93 S A 0.0000
94 H A -0.0292
95 S A -0.3546
96 G A -0.3882
97 G A 0.0000
98 I A 0.4848
99 N A 0.0000
100 V A 0.0000
101 F A 0.0537
102 G A 0.0000
103 G A -1.1681
104 G A -1.3141
105 T A 0.0000
106 K A -2.4553
107 L A 0.0000
108 T A -0.7847
109 V A 0.0000
110 L A 0.2270
111 G A -0.3195
112 G A -1.0961
113 G A -0.8818
114 G A -1.4677
115 S A -1.3712
116 G A -1.4389
117 G A -1.7998
118 G A -1.4241
119 G A -1.2414
120 S A -1.1111
121 G A -1.2183
122 G A -1.2636
123 G A -1.4047
124 G A -1.6064
125 S A -1.6646
126 E A -2.5033
127 V A 0.0000
128 Q A -1.6145
129 L A 0.0000
130 V A 0.4946
131 E A 0.0000
132 S A -0.3473
133 G A -0.8044
134 G A 0.0838
135 G A 0.5872
136 L A 1.3247
137 V A 0.0000
138 Q A -1.3915
139 P A -1.6070
140 G A -1.4075
141 G A -0.9902
142 S A -1.3326
143 L A -1.0814
144 R A -2.1588
145 L A 0.0000
146 S A -0.4833
147 C A 0.0000
148 A A -0.2688
149 A A 0.0000
150 S A -1.2112
151 G A -1.4606
152 F A -0.7758
153 T A -0.5690
154 F A 0.0000
155 S A -1.1820
156 N A -1.4633
157 Y A -0.5929
158 L A -0.1486
159 M A 0.0000
160 A A 0.0000
161 W A 0.0000
162 V A 0.0000
163 R A 0.0000
164 Q A -0.6030
165 A A -1.0272
166 P A -0.8169
167 G A -1.4454
168 K A -2.2636
169 G A -1.4420
170 L A 0.0000
171 E A -0.9857
172 W A 0.0000
173 V A 0.0000
174 S A 0.0000
175 T A 0.0000
176 I A 0.0000
177 S A -0.4933
178 S A -0.8614
179 S A -1.0282
180 G A -0.8024
181 S A -0.9839
182 R A -1.2940
183 I A 0.6058
184 Y A 0.2949
185 Y A -0.3486
186 P A -1.2173
187 D A -2.5030
188 S A -1.7378
189 V A 0.0000
190 K A -2.6191
191 G A -1.8026
192 R A -1.5968
193 F A 0.0000
194 T A -0.6769
195 I A 0.0000
196 S A -0.3938
197 R A -0.9582
198 D A -1.4196
199 N A -1.6769
200 A A -1.2864
201 K A -2.2358
202 N A -1.6768
203 S A 0.0000
204 L A 0.0000
205 Y A -0.5382
206 L A 0.0000
207 Q A -1.2773
208 M A 0.0000
209 N A -1.5353
210 S A -1.2547
211 L A 0.0000
212 R A -2.2750
213 A A -1.7147
214 E A -2.2203
215 D A 0.0000
216 T A -0.3569
217 A A 0.0000
218 V A 0.8580
219 Y A 0.0000
220 Y A 0.0000
221 C A 0.0000
222 A A 0.0000
223 R A 0.0000
224 H A 0.0000
225 L A -0.7967
226 R A -2.0009
227 D A -1.4407
228 G A 0.0000
229 G A 0.0000
230 F A 0.0000
231 D A -0.0234
232 Y A 0.1174
233 W A -0.0873
234 G A 0.0000
235 Q A -1.0933
236 G A -0.0111
237 T A 0.5126
238 L A 1.6534
239 V A 0.0000
240 T A 0.3214
241 V A 0.0000
242 S A -0.7216
243 S A -0.7010
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7022 2.3099 View CSV PDB
4.5 -0.741 2.3099 View CSV PDB
5.0 -0.7843 2.3099 View CSV PDB
5.5 -0.8257 2.3099 View CSV PDB
6.0 -0.8576 2.3099 View CSV PDB
6.5 -0.8745 2.3099 View CSV PDB
7.0 -0.8767 2.3099 View CSV PDB
7.5 -0.8692 2.3099 View CSV PDB
8.0 -0.8552 2.3099 View CSV PDB
8.5 -0.8346 2.3099 View CSV PDB
9.0 -0.8067 2.3099 View CSV PDB