Project name: RFA148_alphafold

Status: done

Started: 2026-06-14 15:26:54
Chain sequence(s) A: EVQLVESGGGLEQPGGSLRLSCAGSGFTFSSQGFGWVRQAPGKGLEWVSSISADGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLSRVRVGSTRGVVGDVWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISCRSSVETSAIGWYLQKSGQSPQLLIYGTSTRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQGTGVPGTFGQGTKLEIKRTV
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1b7a223180e55f0/tmp/folded.pdb                (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:46)
Show buried residues

Minimal score value
-3.1893
Maximal score value
1.5654
Average score
-0.6922
Total score value
-163.3556

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.6626
2 V A -0.2926
3 Q A -0.6527
4 L A 0.0000
5 V A 0.9519
6 E A 0.0000
7 S A -0.4719
8 G A -1.0193
9 G A -0.5249
10 G A 0.0818
11 L A 0.9101
12 E A -0.6786
13 Q A -1.6969
14 P A -1.8407
15 G A -1.5594
16 G A -1.1262
17 S A -1.3532
18 L A -0.9991
19 R A -2.1301
20 L A 0.0000
21 S A -0.4115
22 C A 0.0000
23 A A -0.1566
24 G A 0.0000
25 S A -0.5646
26 G A -0.8275
27 F A -0.2681
28 T A -0.1932
29 F A 0.0000
30 S A -1.2243
31 S A -0.6552
32 Q A -0.8832
33 G A -0.8006
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.8675
40 A A -1.2537
41 P A -1.0114
42 G A -1.4509
43 K A -2.3749
44 G A -1.5091
45 L A 0.0000
46 E A -1.0615
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.4342
51 I A 0.0000
52 S A -0.7571
53 A A -1.2306
54 D A -2.1919
55 G A -1.3941
56 S A -0.8989
57 G A -0.4159
58 T A 0.2817
59 Y A 0.8514
60 Y A -0.2137
61 A A 0.0000
62 D A -2.6304
63 S A -1.7931
64 V A 0.0000
65 K A -2.5137
66 G A -1.7588
67 R A -1.5102
68 F A 0.0000
69 T A -0.7270
70 I A 0.0000
71 S A -0.4161
72 R A -1.2115
73 D A -1.6823
74 N A -1.9799
75 S A -1.5941
76 K A -2.3691
77 N A -1.7615
78 T A -1.0088
79 L A 0.0000
80 Y A -0.5654
81 L A 0.0000
82 Q A -1.2338
83 M A 0.0000
84 N A -1.4665
85 S A -1.3308
86 L A 0.0000
87 R A -2.8577
88 A A -2.0227
89 E A -2.4118
90 D A 0.0000
91 T A -0.8259
92 A A 0.0000
93 V A -0.0407
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.3762
99 L A -0.4344
100 S A -0.8532
101 R A -2.4089
102 V A -1.8348
103 R A -2.6665
104 V A -0.9909
105 G A -1.0655
106 S A -1.1022
107 T A -1.7004
108 R A -2.8096
109 G A 0.0000
110 V A -0.8603
111 V A 0.0000
112 G A 0.0000
113 D A -0.6957
114 V A -0.1320
115 W A -0.3014
116 G A 0.0000
117 Q A -1.2621
118 G A -0.5125
119 T A -0.2430
120 T A -0.0698
121 V A 0.0000
122 T A -0.2621
123 V A 0.0000
124 S A -0.8784
125 S A -0.8304
126 A A -0.4218
127 S A -0.4112
1 D B -1.0441
2 I B 0.4034
3 V B 1.2266
4 M B 0.0000
5 T B -0.2452
6 Q B 0.0000
7 S B -0.0695
8 P B 0.2324
9 L B 0.6594
10 S B -0.0139
11 L B -0.1568
12 P B -1.1011
13 V B 0.0000
14 T B -1.6132
15 P B -1.7300
16 G B -1.6895
17 E B -1.8524
18 P B -1.9878
19 A B 0.0000
20 S B -0.8563
21 I B 0.0000
22 S B -0.8200
23 C B 0.0000
24 R B -1.5131
25 S B 0.0000
26 S B -0.2105
27 V B -0.3794
28 E B -1.9264
29 T B 0.0000
30 S B -1.3834
31 A B 0.0000
32 I B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B 0.0000
38 K B -1.5551
39 S B -0.9927
40 G B -1.5098
41 Q B -2.1347
42 S B -1.3881
43 P B 0.0000
44 Q B -1.0022
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.1795
49 G B -0.7112
50 T B 0.0000
51 S B -0.4598
52 T B -0.5628
53 R B -1.4495
54 G B -0.8475
55 S B -0.7478
56 G B -0.8987
57 V B -1.0058
58 P B -1.2910
59 D B -2.3925
60 R B -2.1842
61 F B 0.0000
62 S B -1.4540
63 G B 0.0000
64 S B -1.0190
65 G B -1.2521
66 S B -1.4211
67 G B -1.5722
68 T B -1.8649
69 D B -2.5812
70 F B 0.0000
71 T B -1.1865
72 L B 0.0000
73 K B -2.1215
74 I B 0.0000
75 S B -2.3343
76 R B -3.1893
77 V B 0.0000
78 E B -2.5460
79 A B -1.3803
80 E B -2.1144
81 D B 0.0000
82 V B -0.4558
83 G B 0.0000
84 F B 0.1546
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B -0.0430
91 T B -0.6587
92 G B 0.3584
93 V B 1.5654
94 P B 0.5764
95 G B 0.5555
96 T B 0.1375
97 F B 0.0324
98 G B 0.0000
99 Q B -1.1444
100 G B 0.0000
101 T B 0.0000
102 K B -0.5816
103 L B 0.0000
104 E B -1.1936
105 I B -1.3667
106 K B -2.2791
107 R B -2.1370
108 T B -0.4847
109 V B 0.9775
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7805 1.9306 View CSV PDB
4.5 -0.8294 1.86 View CSV PDB
5.0 -0.8868 1.7801 View CSV PDB
5.5 -0.9441 1.6967 View CSV PDB
6.0 -0.9919 1.6121 View CSV PDB
6.5 -1.0224 1.5273 View CSV PDB
7.0 -1.0347 1.4427 View CSV PDB
7.5 -1.0342 1.3594 View CSV PDB
8.0 -1.0261 1.3043 View CSV PDB
8.5 -1.0114 1.4142 View CSV PDB
9.0 -0.9894 1.5709 View CSV PDB