Project name: 1ba637faec03c73

Status: done

Started: 2025-03-19 11:33:49
Chain sequence(s) A: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1ba637faec03c73/tmp/folded.pdb                (00:03:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:06)
Show buried residues

Minimal score value
-3.6728
Maximal score value
2.0154
Average score
-1.2574
Total score value
-350.8209

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.2509
2 T A -0.8604
3 E A -2.3444
4 R A -2.3523
5 F A -1.1594
6 D A -1.7631
7 C A 0.0000
8 H A -1.9649
9 H A -1.6447
10 C A -1.3936
11 N A -2.8037
12 E A -2.6060
13 S A -1.4070
14 L A 0.0000
15 F A 0.6735
16 G A -0.5438
17 K A -1.8949
18 K A -1.5298
19 Y A 0.4413
20 I A 0.8491
21 L A 0.1001
22 R A -1.6302
23 E A -2.8471
24 E A -2.6032
25 S A -1.7798
26 P A -0.6344
27 Y A 0.0000
28 C A -0.1283
29 V A 0.9711
30 V A 2.0154
31 C A 1.1621
32 F A 1.2547
33 E A 0.6756
34 T A 0.6176
35 L A 1.0492
36 F A 0.8596
37 A A -0.0616
38 N A -1.5221
39 T A -1.7739
40 C A 0.0000
41 E A -2.5333
42 E A -2.2684
43 C A -1.1828
44 G A -1.8211
45 K A -2.3526
46 P A -1.2948
47 I A 0.0000
48 G A -0.8941
49 C A -0.5953
50 D A -1.9702
51 C A -1.9412
52 K A -2.8349
53 D A -2.4900
54 L A -1.5853
55 S A -1.8577
56 Y A -1.4512
57 K A -2.7832
58 D A -3.2060
59 R A -3.2911
60 H A -2.6286
61 W A 0.0000
62 H A -2.1466
63 E A -2.1298
64 A A -1.2550
65 C A -1.1300
66 F A 0.0000
67 H A -1.5039
68 C A 0.0000
69 S A -1.7869
70 Q A -1.8783
71 C A -1.4085
72 R A -2.3211
73 N A -1.6104
74 S A -1.4425
75 L A 0.0000
76 V A -1.3958
77 D A -2.2173
78 K A -1.9395
79 P A -0.9030
80 F A -0.3193
81 A A -0.5849
82 A A -1.2563
83 K A -2.3998
84 E A -3.3574
85 D A -3.6330
86 Q A -2.9849
87 L A 0.0000
88 L A 0.0000
89 C A -1.1287
90 T A -0.8556
91 D A -2.0673
92 C A 0.0000
93 Y A -0.9095
94 S A 0.0000
95 N A -2.1560
96 E A -1.9227
97 Y A 0.0312
98 S A -0.4902
99 S A -1.4149
100 K A -2.4534
101 C A 0.0000
102 Q A -2.4109
103 E A -1.9660
104 C A -1.8881
105 K A -3.2109
106 K A -3.0798
107 T A -2.1561
108 I A 0.0000
109 M A -0.6860
110 P A -0.5504
111 G A -1.0782
112 T A -1.5398
113 R A -2.9778
114 K A -3.0259
115 M A -1.9968
116 E A -2.7210
117 Y A -1.3617
118 K A -2.0970
119 G A -1.6606
120 S A -1.5923
121 S A 0.0000
122 W A 0.0000
123 H A -2.1781
124 E A -1.7306
125 T A -1.0632
126 C A -0.8334
127 F A 0.0000
128 I A -0.8473
129 C A 0.0000
130 H A -1.4601
131 R A -1.6606
132 C A -1.0819
133 Q A -1.8690
134 Q A -1.7866
135 P A -1.1320
136 I A 0.0000
137 G A -0.9851
138 T A -0.8566
139 K A -1.4342
140 S A -0.5311
141 F A 0.2504
142 I A 0.3096
143 P A -0.9835
144 K A -2.2621
145 D A -3.0490
146 N A -2.7305
147 Q A -2.1878
148 N A 0.0000
149 F A -0.3253
150 C A 0.0000
151 V A -0.0735
152 P A -0.7788
153 C A -1.0130
154 Y A -1.2736
155 E A -1.7913
156 K A -2.7281
157 Q A -2.5708
158 H A -2.0278
159 A A -1.5882
160 M A -0.9637
161 Q A -2.4722
162 C A 0.0000
163 V A -1.1583
164 Q A -1.9574
165 C A -1.7614
166 K A -2.9052
167 K A -3.0245
168 P A -2.2961
169 I A 0.0000
170 T A -1.1951
171 T A -0.5768
172 G A -0.7500
173 G A -0.9361
174 V A -0.7801
175 T A -1.2095
176 Y A -1.4505
177 R A -3.0723
178 E A -2.9790
179 Q A -2.1855
180 P A -1.3892
181 W A -1.4308
182 H A -1.9689
183 K A -2.4162
184 E A -3.1807
185 C A -1.9089
186 F A 0.0000
187 V A -1.7386
188 C A 0.0000
189 T A -0.0828
190 A A -0.0156
191 C A -1.0189
192 R A -2.6362
193 K A -2.8709
194 Q A -3.0916
195 L A 0.0000
196 S A -1.8345
197 G A -1.5880
198 Q A -2.2926
199 R A -2.2485
200 F A -0.7972
201 T A -0.2423
202 A A -0.5799
203 R A -1.8448
204 D A -2.5809
205 D A -2.2674
206 F A 0.1822
207 A A 0.0000
208 Y A 0.0000
209 C A 0.0000
210 L A -0.5309
211 N A -1.2009
212 C A -0.2263
213 F A 0.1274
214 C A 0.0000
215 D A -1.6061
216 L A 0.6019
217 Y A 0.0597
218 A A -1.2572
219 K A -2.7450
220 K A -2.5571
221 C A 0.0000
222 A A -1.6995
223 G A -1.4998
224 C A -0.5730
225 T A -1.1360
226 N A -2.0692
227 P A -1.8707
228 I A 0.0000
229 S A -1.1588
230 G A -0.7875
231 L A 0.1230
232 G A -0.6730
233 G A -0.9983
234 T A -1.0994
235 K A -1.6413
236 Y A -0.2938
237 I A -0.1372
238 S A -1.0390
239 F A -1.1499
240 E A -2.8901
241 E A -3.4384
242 R A -3.3417
243 Q A -1.8401
244 W A 0.0000
245 H A -1.1461
246 N A -1.1597
247 D A -1.7820
248 C A -0.8815
249 F A 0.0000
250 N A -1.1778
251 C A 0.0000
252 K A -2.8243
253 K A -2.5035
254 C A -0.9081
255 S A -0.7440
256 L A -0.1113
257 S A -0.6765
258 L A 0.0000
259 V A -0.4078
260 G A -1.0839
261 R A -1.9673
262 G A -1.0987
263 F A -0.2806
264 L A -0.1480
265 T A -1.0153
266 E A -2.2807
267 R A -3.4014
268 D A -3.6728
269 D A -3.1122
270 I A 0.0000
271 L A 0.0000
272 C A 0.0000
273 P A -1.5865
274 D A -2.6194
275 C A -1.7393
276 G A 0.0000
277 K A -2.4871
278 D A -1.8935
279 I A 0.5074
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.1351 3.5826 View CSV PDB
4.5 -1.2265 3.307 View CSV PDB
5.0 -1.3355 2.9877 View CSV PDB
5.5 -1.4377 2.6498 View CSV PDB
6.0 -1.5108 2.3055 View CSV PDB
6.5 -1.5405 2.0551 View CSV PDB
7.0 -1.5271 2.1817 View CSV PDB
7.5 -1.4841 2.3552 View CSV PDB
8.0 -1.4252 2.5502 View CSV PDB
8.5 -1.3552 2.7546 View CSV PDB
9.0 -1.2722 2.9629 View CSV PDB