Project name: ceff487664a2023 [mutate: LK215A, YH49A]

Status: done

Started: 2026-04-11 12:36:28
Chain sequence(s) A: QKEVEQSPGPLSVPEGATVSLNCTYSNSAFQYFLWYRQDPGEGPELLMYTYSSGNKEKGRFTLKVDKSRKRISLRIRDVQPSDSATYLCAMSADNYGQNFVFGPGTRLTVTPGGGSEGGGSEGGGSEGGGSEGGTGNAGVTQTPESITLPEGASMTLQCRQDMNHEYMLWYRQDPGKGLILIFYSVGAGITDQGEVPEGYSVSRPTLEDFPLRLLSAQPEDTAVYFCASSYSVGEGNLGDTQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues YH49A,LK215A
Energy difference between WT (input) and mutated protein (by FoldX) 0.542867 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:53)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1d5e6736df8f8a2/tmp/folded.pdb                (00:01:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:30)
Show buried residues

Minimal score value
-3.6728
Maximal score value
1.5683
Average score
-0.91
Total score value
-230.2186

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -2.4148
2 K A -3.0513
3 E A -2.3534
4 V A 0.0000
5 E A -2.8307
6 Q A -1.4632
7 S A -1.0096
8 P A -0.9470
9 G A -1.0119
10 P A -1.1359
11 L A -0.4131
12 S A -0.4258
13 V A -0.3485
14 P A -1.2820
15 E A -2.1958
16 G A -2.1561
17 A A -1.5228
18 T A -1.5564
19 V A 0.0000
20 S A -0.6973
21 L A 0.0000
22 N A -1.1899
23 C A 0.0000
24 T A -2.0782
25 Y A 0.0000
26 S A -1.8030
27 N A -1.0077
28 S A -0.8878
29 A A -0.5680
30 F A 0.0000
31 Q A -0.9971
32 Y A -0.1100
33 F A 0.0000
34 L A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 R A -1.2365
38 Q A -1.5211
39 D A -1.6846
40 P A -1.3504
41 G A -1.7247
42 E A -2.0666
43 G A -1.1921
44 P A 0.0000
45 E A -1.3467
46 L A -0.3086
47 L A 0.0000
48 M A 0.0000
49 H A -0.0842 mutated: YH49A
50 T A -0.1297
51 Y A 0.7436
52 S A -0.3895
53 S A -1.0276
54 G A -1.3637
55 N A -2.5865
56 K A -2.9821
57 E A -3.6728
58 K A -3.0585
59 G A -2.1130
60 R A -2.3823
61 F A -2.1883
62 T A 0.0000
63 L A 0.0000
64 K A -2.1249
65 V A 0.0000
66 D A -2.0935
67 K A -2.3319
68 S A -1.8922
69 R A -2.8205
70 K A -2.4370
71 R A -2.4225
72 I A 0.0000
73 S A 0.0000
74 L A 0.0000
75 R A -1.3725
76 I A 0.0000
77 R A -2.7720
78 D A -3.0335
79 V A 0.0000
80 Q A -1.7264
81 P A -0.8692
82 S A -0.6331
83 D A 0.0000
84 S A -0.7691
85 A A 0.0000
86 T A 0.0000
87 Y A 0.0000
88 L A 0.0000
89 C A 0.0000
90 A A 0.0000
91 M A 0.0000
92 S A 0.0000
93 A A -0.6594
94 D A -0.6129
95 N A 0.0412
96 Y A 0.7584
97 G A 0.0000
98 Q A -0.5159
99 N A -1.4289
100 F A 0.0000
101 V A -0.3081
102 F A 0.0000
103 G A 0.0000
104 P A -1.4593
105 G A -1.4384
106 T A 0.0000
107 R A -2.2083
108 L A 0.0000
109 T A -0.7617
110 V A 0.0000
111 T A -0.8621
112 P A -1.1878
113 G A -1.4121
114 G A -1.4295
115 G A -1.4873
116 S A -1.6825
117 E A -2.5137
118 G A -1.8319
119 G A -1.4674
120 G A -1.5630
121 S A -1.5808
122 E A -2.3549
123 G A -1.7447
124 G A -1.3328
125 G A -1.3383
126 S A -1.6052
127 E A -2.4179
128 G A -1.7816
129 G A -1.6332
130 G A -1.7301
131 S A -1.7425
132 E A -2.5068
133 G A -1.8092
134 G A -1.5525
135 T A -1.1830
136 G A -1.2702
137 N A -1.0964
138 A A -0.6631
139 G A -1.1053
140 V A 0.0000
141 T A -1.2084
142 Q A 0.0000
143 T A -1.1839
144 P A -1.2493
145 E A -2.3635
146 S A -1.5067
147 I A -0.4574
148 T A -0.3631
149 L A 0.0000
150 P A -1.3678
151 E A -2.3920
152 G A -1.8595
153 A A -1.2451
154 S A -1.3154
155 M A -0.5303
156 T A -0.7477
157 L A 0.0000
158 Q A -1.0908
159 C A 0.0000
160 R A -2.3299
161 Q A 0.0000
162 D A -2.6558
163 M A -1.5067
164 N A -1.9467
165 H A 0.0000
166 E A -0.6236
167 Y A 0.0000
168 M A 0.0000
169 L A 0.0000
170 W A 0.0000
171 Y A 0.0000
172 R A -0.3779
173 Q A -0.7395
174 D A 0.0000
175 P A -0.8962
176 G A -1.6042
177 K A -1.7392
178 G A -0.8489
179 L A 0.0000
180 I A -0.3932
181 L A 0.0000
182 I A 0.0000
183 F A 0.0000
184 Y A -0.4257
185 S A 0.0000
186 V A 0.8359
187 G A 0.4519
188 A A 0.2199
189 G A 0.4814
190 I A 1.5683
191 T A 0.0020
192 D A -1.5389
193 Q A -2.4734
194 G A -2.1205
195 E A -2.2364
196 V A -1.2626
197 P A -1.8170
198 E A -2.5075
199 G A -2.0183
200 Y A 0.0000
201 S A -1.2049
202 V A -0.3123
203 S A -0.2363
204 R A 0.0000
205 P A -0.3067
206 T A -0.6659
207 L A -0.9235
208 E A -2.3066
209 D A -1.5641
210 F A 0.0000
211 P A -0.7585
212 L A 0.0000
213 R A -1.6151
214 L A 0.0000
215 K A -2.3883 mutated: LK215A
216 S A -1.8324
217 A A 0.0000
218 Q A -2.1590
219 P A -1.8019
220 E A -2.0645
221 D A 0.0000
222 T A -1.0505
223 A A 0.0000
224 V A -0.7617
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 Y A 0.4893
232 S A 0.3635
233 V A 0.4000
234 G A -0.9948
235 E A -2.2367
236 G A -1.5606
237 N A -0.9571
238 L A 0.1218
239 G A 0.0000
240 D A 0.0000
241 T A 0.1865
242 Q A 0.0000
243 Y A 0.3186
244 F A 0.0000
245 G A 0.0000
246 P A -1.3702
247 G A 0.0000
248 T A 0.0000
249 R A -2.2031
250 L A 0.0000
251 T A -0.7972
252 V A -0.9659
253 T A -0.7763
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5391 3.3275 View CSV PDB
4.5 -0.596 3.2753 View CSV PDB
5.0 -0.6709 3.2079 View CSV PDB
5.5 -0.7511 3.1335 View CSV PDB
6.0 -0.8228 3.0565 View CSV PDB
6.5 -0.8735 2.9787 View CSV PDB
7.0 -0.8976 2.9008 View CSV PDB
7.5 -0.9015 2.8233 View CSV PDB
8.0 -0.8948 2.7473 View CSV PDB
8.5 -0.8822 2.6758 View CSV PDB
9.0 -0.8648 2.6151 View CSV PDB