Project name: 1e182c03078a69

Status: done

Started: 2025-02-21 07:07:02
Chain sequence(s) A: MSISGAVLSGLGPSFLISGGKRSGVGGGAMKVGRKNVIIAPQRKKSWVSAAVKGAGNSPNDPKWLDDASEKASGYVKEKGSEVGNVSAQKGQELQNQMERAKDYIFGKAGEAMDSVAENAKRASDFVTEKGKEVKEETTSRTDKAKDFIVEKAGDVKDTAMDMRNKTSKYVGDKATEAKEAILPPKTDA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-4.478
Maximal score value
3.294
Average score
-1.4149
Total score value
-267.4236

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.3844
2 S A 1.3215
3 I A 1.9162
4 S A 0.6779
5 G A 0.5194
6 A A 1.2171
7 V A 2.3256
8 L A 2.3565
9 S A 1.1184
10 G A 0.5693
11 L A 1.1636
12 G A 0.1913
13 P A 0.2963
14 S A 1.1648
15 F A 2.9854
16 L A 3.2822
17 I A 2.9853
18 S A 1.0467
19 G A -0.5910
20 G A -1.8038
21 K A -2.9694
22 R A -2.9931
23 S A -1.3453
24 G A -0.2511
25 V A 1.1733
26 G A -0.0841
27 G A -0.5371
28 G A -0.5162
29 A A 0.0128
30 M A 0.5811
31 K A -0.6254
32 V A 0.4208
33 G A -1.3816
34 R A -2.8309
35 K A -2.4512
36 N A -0.8896
37 V A 2.0691
38 I A 3.2940
39 I A 3.1375
40 A A 1.1902
41 P A -0.7658
42 Q A -2.6218
43 R A -3.8893
44 K A -3.6738
45 K A -2.8064
46 S A -0.6567
47 W A 1.1978
48 V A 1.9635
49 S A 1.2670
50 A A 0.8846
51 A A 0.5313
52 V A 0.8107
53 K A -1.0969
54 G A -1.1502
55 A A -0.9065
56 G A -1.7117
57 N A -2.5155
58 S A -2.1110
59 P A -1.7598
60 N A -2.3130
61 D A -3.0625
62 P A -2.5052
63 K A -3.4885
64 W A -2.4280
65 L A -1.9321
66 D A -3.6646
67 D A -3.8782
68 A A -2.4751
69 S A -2.5760
70 E A -3.3999
71 K A -2.9825
72 A A -1.6281
73 S A -1.4555
74 G A -1.5648
75 Y A -0.1972
76 V A 0.0116
77 K A -2.2322
78 E A -2.6006
79 K A -1.9350
80 G A -1.4463
81 S A -2.0597
82 E A -2.6009
83 V A -1.2839
84 G A -1.2385
85 N A -1.3710
86 V A -1.0359
87 S A -1.2040
88 A A -1.7011
89 Q A -2.7751
90 K A -3.4154
91 G A -2.6132
92 Q A -3.8644
93 E A -4.3796
94 L A -3.1165
95 Q A -3.6857
96 N A -4.4539
97 Q A -4.0329
98 M A -2.9098
99 E A -4.4780
100 R A -3.8411
101 A A -2.2180
102 K A -2.5542
103 D A -2.3722
104 Y A -0.2473
105 I A 0.0948
106 F A 0.6835
107 G A -0.6850
108 K A -1.4540
109 A A -0.4333
110 G A -0.9605
111 E A -2.2197
112 A A -1.1449
113 M A -0.5557
114 D A -2.3492
115 S A -1.5355
116 V A -0.3884
117 A A -1.6709
118 E A -3.2539
119 N A -3.0536
120 A A -2.2079
121 K A -3.4239
122 R A -3.2828
123 A A -1.7406
124 S A -1.9311
125 D A -2.5728
126 F A -0.1982
127 V A 0.0857
128 T A -1.8962
129 E A -3.0239
130 K A -2.9673
131 G A -2.5032
132 K A -3.9934
133 E A -4.1997
134 V A -2.3206
135 K A -3.6605
136 E A -3.7098
137 E A -3.0383
138 T A -1.8260
139 T A -1.4904
140 S A -1.6058
141 R A -2.6325
142 T A -2.7471
143 D A -3.6725
144 K A -3.1853
145 A A -1.6510
146 K A -2.2002
147 D A -2.0467
148 F A 0.4188
149 I A 1.4268
150 V A 0.5211
151 E A -1.6040
152 K A -1.6014
153 A A -0.7405
154 G A -1.9950
155 D A -2.9367
156 V A -1.1435
157 K A -2.4054
158 D A -2.8349
159 T A -1.6872
160 A A -0.8887
161 M A -1.4209
162 D A -2.5670
163 M A -2.2330
164 R A -2.9394
165 N A -3.1591
166 K A -2.9757
167 T A -1.6103
168 S A -2.0974
169 K A -2.6483
170 Y A -0.7863
171 V A -0.1529
172 G A -1.5527
173 D A -2.7539
174 K A -2.5434
175 A A -2.0352
176 T A -2.6239
177 E A -3.6171
178 A A -2.0951
179 K A -2.5274
180 E A -2.3849
181 A A -0.6014
182 I A 0.8950
183 L A 0.9219
184 P A -0.1045
185 P A -1.1336
186 K A -2.2217
187 T A -1.8915
188 D A -2.3678
189 A A -1.0716
Download PDB file
View in 3Dmol