Project name: 1f3293ae3bf9f40

Status: done

Started: 2026-06-04 11:14:45
Chain sequence(s) A: SAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLVSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQSALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLVSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQSALKQVSAQNKPASAKDQLKQRVQKLQEKVSQQIAQDPNLSAQQRFLVSHAVYEDISHVQDTISTLDPSAANQVVDQAAQQLQSALKQVSAQNKPA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:36)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1f3293ae3bf9f40/tmp/folded.pdb                (00:06:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:43)
Show buried residues

Minimal score value
-4.0349
Maximal score value
1.5367
Average score
-1.5286
Total score value
-380.6096

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -1.8168
2 A A -2.3838
3 K A -3.6839
4 D A -3.9334
5 Q A -3.4697
6 L A 0.0000
7 K A -3.8407
8 Q A -3.4865
9 R A -3.1505
10 V A 0.0000
11 Q A -3.2103
12 K A -3.7808
13 L A 0.0000
14 Q A -2.7469
15 E A -4.0349
16 K A -3.9230
17 V A 0.0000
18 S A -2.4006
19 Q A -3.0036
20 Q A -2.9488
21 I A 0.0000
22 A A -1.3794
23 Q A -1.9430
24 D A 0.0000
25 P A -1.1080
26 N A -1.4762
27 L A 0.0000
28 S A -0.5616
29 A A -0.3347
30 Q A -0.6526
31 Q A -0.2878
32 R A -0.2332
33 F A 1.3290
34 L A 1.5367
35 V A 0.7086
36 S A -0.0471
37 H A -0.2445
38 A A -0.4812
39 V A 0.0000
40 Y A -0.8540
41 E A -2.7000
42 D A -2.9397
43 I A 0.0000
44 S A -2.1769
45 H A -2.7319
46 V A -1.8080
47 Q A -2.3580
48 D A -2.5769
49 T A -1.1953
50 I A 0.0000
51 S A -1.5331
52 T A -0.6716
53 L A -0.6087
54 D A -1.8181
55 P A -1.6490
56 S A -1.0504
57 A A -1.0487
58 A A 0.0000
59 N A -1.6996
60 Q A -1.9036
61 V A -0.9509
62 V A 0.0000
63 D A -2.5771
64 Q A -2.3891
65 A A 0.0000
66 A A -2.1710
67 Q A -2.6248
68 Q A -2.5831
69 L A 0.0000
70 Q A -2.3802
71 S A -1.9957
72 A A -1.5308
73 L A 0.0000
74 K A -2.7468
75 Q A -2.4152
76 V A -1.3886
77 S A -1.9422
78 A A -1.9989
79 Q A -2.3012
80 N A -2.1375
81 K A -2.4935
82 P A -1.6270
83 A A -1.6408
84 S A -1.7661
85 A A -2.1341
86 K A -3.3538
87 D A -3.2005
88 Q A -2.9665
89 L A 0.0000
90 K A -3.8625
91 Q A -3.3865
92 R A -3.1235
93 V A 0.0000
94 Q A -3.3064
95 K A -3.8468
96 L A 0.0000
97 Q A -2.6980
98 E A -3.9496
99 K A -3.7467
100 V A 0.0000
101 S A -2.2593
102 Q A -2.6790
103 Q A -2.3005
104 I A 0.0000
105 A A -1.1956
106 Q A -1.7473
107 D A 0.0000
108 P A -1.0575
109 N A -1.4860
110 L A 0.0000
111 S A -0.5701
112 A A -0.3422
113 Q A -0.6658
114 Q A -0.3158
115 R A -0.1813
116 F A 1.2903
117 L A 1.4350
118 V A 0.8307
119 S A -0.0414
120 H A -0.3225
121 A A -0.5452
122 V A 0.0000
123 Y A -0.9115
124 E A -2.7747
125 D A -2.8511
126 I A 0.0000
127 S A -2.2089
128 H A -2.7612
129 V A -1.8254
130 Q A -2.4175
131 D A -2.4127
132 T A -1.1887
133 I A 0.0000
134 S A -1.5954
135 T A -0.6702
136 L A -0.5942
137 D A -1.8906
138 P A -1.6146
139 S A -1.0592
140 A A -1.0654
141 A A 0.0000
142 N A -1.7001
143 Q A -1.9232
144 V A -0.9559
145 V A 0.0000
146 D A -2.6328
147 Q A -2.4090
148 A A -2.0222
149 A A -2.1503
150 Q A -2.5893
151 Q A -2.5463
152 L A 0.0000
153 Q A -2.1645
154 S A -1.9388
155 A A -1.4932
156 L A 0.0000
157 K A -2.6507
158 Q A -2.4015
159 V A -1.3937
160 S A -1.8930
161 A A -1.9918
162 Q A -2.3057
163 N A -2.1572
164 K A -2.4996
165 P A -1.6407
166 A A -1.6406
167 S A -1.7778
168 A A -2.1133
169 K A -3.3410
170 D A -3.1791
171 Q A -2.9050
172 L A 0.0000
173 K A -3.7669
174 Q A -3.2061
175 R A -3.0467
176 V A 0.0000
177 Q A -3.2330
178 K A -3.7903
179 L A 0.0000
180 Q A -2.6862
181 E A -3.9984
182 K A -3.8733
183 V A 0.0000
184 S A -2.3397
185 Q A -2.9355
186 Q A -2.8508
187 I A 0.0000
188 A A -1.2936
189 Q A -1.9105
190 D A 0.0000
191 P A -1.0884
192 N A -1.4458
193 L A 0.0000
194 S A -0.5260
195 A A -0.2732
196 Q A -0.5828
197 Q A -0.2300
198 R A -0.1358
199 F A 1.5166
200 L A 1.5184
201 V A 0.8937
202 S A -0.0319
203 H A -0.3390
204 A A -0.5365
205 V A 0.0000
206 Y A -0.8799
207 E A -2.7335
208 D A -2.7630
209 I A 0.0000
210 S A -2.1320
211 H A -2.6758
212 V A -1.7939
213 Q A -2.2950
214 D A -2.3639
215 T A -1.1658
216 I A 0.0000
217 S A -1.4761
218 T A -0.6682
219 L A -0.6204
220 D A -1.8967
221 P A -1.5992
222 S A -1.0511
223 A A -1.0637
224 A A 0.0000
225 N A -1.7420
226 Q A -2.0111
227 V A -1.0640
228 V A 0.0000
229 D A -2.7986
230 Q A -2.7633
231 A A -2.1860
232 A A -2.2749
233 Q A -2.7188
234 Q A -2.6474
235 L A 0.0000
236 Q A -2.2769
237 S A -1.9143
238 A A -1.4883
239 L A 0.0000
240 K A -2.7071
241 Q A -2.3962
242 V A -1.3613
243 S A -1.9247
244 A A -2.0071
245 Q A -2.3094
246 N A -2.1569
247 K A -2.4811
248 P A -1.3861
249 A A -0.6650
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.3443 3.2974 View CSV PDB
4.5 -1.4206 3.3057 View CSV PDB
5.0 -1.5051 3.3273 View CSV PDB
5.5 -1.5752 3.3714 View CSV PDB
6.0 -1.613 3.4317 View CSV PDB
6.5 -1.6164 3.4841 View CSV PDB
7.0 -1.594 3.5135 View CSV PDB
7.5 -1.554 3.5257 View CSV PDB
8.0 -1.5016 3.5299 View CSV PDB
8.5 -1.4364 3.5313 View CSV PDB
9.0 -1.3549 3.5317 View CSV PDB