Project name: TtMqnB wt dimer

Status: done

Started: 2026-07-14 11:13:37
Chain sequence(s) A: MGSSHHHHHHSSGENLYFQGGTMWLLLSPTRLEAPFLQGEPFAFLAWRGLKGPGFVYLETGIGKVNAAMALAAYAARNPVEKALLFGLAGAYPGGPSLGEAVLVEEEVEADLGLKEGLAPLGFPALALGERRYFNRFPLDPGLTGELARGLGLKVAVGLTRDLVSETPEEALALAQRWGASLENMEGAAFARACLALGVRGAELRAISNPAGVREKAHWRTKEALSALARAVRRLLAEEGGARRPPG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1f369a189afe70e/tmp/folded.pdb                (00:02:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:26)
Show buried residues

Minimal score value
-3.6297
Maximal score value
1.9463
Average score
-0.677
Total score value
-167.2235

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.7547
2 G A -0.2298
3 S A -0.6657
4 S A -1.1938
5 H A -2.0714
6 H A -2.4353
7 H A -2.6583
8 H A -2.6497
9 H A -2.4553
10 H A -2.1055
11 S A -1.6201
12 S A -1.6215
13 G A -1.6410
14 E A -1.7205
15 N A -0.4911
16 L A 1.2174
17 Y A 1.2371
18 F A 1.4178
19 Q A -0.2669
20 G A -0.6679
21 G A -0.9674
22 T A -0.7374
23 M A -0.3273
24 W A 0.0000
25 L A 0.0000
26 L A 0.0000
27 L A 0.0000
28 S A 0.0000
29 P A 0.0000
30 T A 0.3094
31 R A -0.2599
32 L A 1.2294
33 E A 0.0000
34 A A 0.0000
35 P A -0.0470
36 F A -0.5510
37 L A 0.0000
38 Q A -1.7896
39 G A -1.8737
40 E A -2.3486
41 P A -1.5612
42 F A -0.4760
43 A A 0.0258
44 F A 0.6812
45 L A 1.4840
46 A A 0.5008
47 W A -0.2668
48 R A -1.5542
49 G A 0.0000
50 L A 0.0000
51 K A -1.2639
52 G A 0.0000
53 P A -0.3458
54 G A -0.3240
55 F A 0.0000
56 V A 0.0000
57 Y A 0.0000
58 L A 0.0000
59 E A -0.5766
60 T A 0.0000
61 G A 0.6518
62 I A 1.8270
63 G A 0.0000
64 K A 0.6868
65 V A 1.7793
66 N A 1.0883
67 A A 0.0000
68 A A 0.7150
69 M A 1.1045
70 A A 0.0000
71 L A 0.0000
72 A A 0.1818
73 A A 0.0000
74 Y A 0.0000
75 A A -0.6870
76 A A -0.8217
77 R A -2.0236
78 N A -1.5142
79 P A -1.1518
80 V A -1.2026
81 E A -2.1075
82 K A -1.4656
83 A A 0.0000
84 L A 0.0000
85 L A 0.0000
86 F A 0.0000
87 G A 0.0000
88 L A 0.4718
89 A A 0.0000
90 G A 0.0000
91 A A 0.0000
92 Y A 0.0000
93 P A -0.5013
94 G A -0.4991
95 G A -0.4054
96 P A -0.4200
97 S A -0.3225
98 L A -0.2731
99 G A -1.0073
100 E A -0.7528
101 A A 0.0000
102 V A 0.0000
103 L A 0.0000
104 V A 0.0000
105 E A -1.2050
106 E A -0.8687
107 E A 0.0000
108 V A 0.0000
109 E A 0.0000
110 A A -1.3088
111 D A -1.3211
112 L A -0.6629
113 G A -0.3543
114 L A -0.8897
115 K A -2.6628
116 E A -2.7096
117 G A 0.0000
118 L A 0.0000
119 A A 0.3041
120 P A 0.3292
121 L A 1.4935
122 G A 0.9353
123 F A 1.9463
124 P A 0.5183
125 A A 0.2866
126 L A -0.1962
127 A A -1.0870
128 L A -1.3819
129 G A -2.0495
130 E A -3.2784
131 R A -3.5569
132 R A -2.6952
133 Y A -0.7614
134 F A 0.4142
135 N A 0.0000
136 R A -0.8243
137 F A 0.0000
138 P A -0.8007
139 L A 0.0000
140 D A -1.3850
141 P A -1.3677
142 G A -1.4427
143 L A 0.0000
144 T A 0.0000
145 G A -1.9236
146 E A -2.8202
147 L A 0.0000
148 A A -2.0391
149 R A -3.0210
150 G A -2.3727
151 L A 0.0000
152 G A -1.6891
153 L A -1.1042
154 K A -1.5857
155 V A 0.0462
156 A A -0.0809
157 V A 0.0225
158 G A 0.0000
159 L A 0.0000
160 T A 0.0000
161 R A 0.0000
162 D A -0.4009
163 L A 0.7686
164 V A 1.4175
165 S A 0.0000
166 E A -1.9377
167 T A -1.5763
168 P A -1.3992
169 E A -1.9146
170 E A -1.1583
171 A A 0.0000
172 L A 0.0255
173 A A -0.8252
174 L A -0.9933
175 A A -0.9700
176 Q A -1.7582
177 R A -2.6772
178 W A -1.5771
179 G A -1.2003
180 A A 0.0000
181 S A -0.1846
182 L A 0.0000
183 E A 0.0000
184 N A 0.0000
185 M A 0.7581
186 E A 0.0000
187 G A 0.0000
188 A A 0.0000
189 A A 0.0000
190 F A 0.0000
191 A A 0.0000
192 R A -0.2490
193 A A 0.2553
194 C A 0.0000
195 L A 0.2015
196 A A 0.4900
197 L A 0.4648
198 G A -0.4983
199 V A 0.0000
200 R A -1.6282
201 G A 0.0000
202 A A 0.0000
203 E A 0.0000
204 L A 0.0000
205 R A 0.0000
206 A A 0.0000
207 I A 0.0000
208 S A 0.0000
209 N A -1.0475
210 P A -0.8987
211 A A 0.0000
212 G A 0.0000
213 V A -1.9987
214 R A -3.5411
215 E A -3.6297
216 K A -3.3757
217 A A -2.0626
218 H A -2.2605
219 W A -2.1006
220 R A -2.1241
221 T A -1.7771
222 K A -2.5092
223 E A -2.3139
224 A A 0.0000
225 L A -0.8837
226 S A -1.3266
227 A A -1.2374
228 L A 0.0000
229 A A -1.5345
230 R A -2.6333
231 A A 0.0000
232 V A 0.0000
233 R A -2.8808
234 R A -3.1161
235 L A 0.0000
236 L A -1.6263
237 A A -2.0114
238 E A -3.0509
239 E A -2.2549
240 G A -2.3310
241 G A -2.4094
242 A A -2.3494
243 R A -3.3946
244 R A -3.1182
245 P A -1.9087
246 P A -1.2800
247 G A -0.9639
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5625 5.1099 View CSV PDB
4.5 -0.6122 5.1099 View CSV PDB
5.0 -0.674 5.1099 View CSV PDB
5.5 -0.7336 5.1099 View CSV PDB
6.0 -0.7753 5.1099 View CSV PDB
6.5 -0.7905 5.1099 View CSV PDB
7.0 -0.7844 5.1099 View CSV PDB
7.5 -0.7681 5.1099 View CSV PDB
8.0 -0.7479 5.1099 View CSV PDB
8.5 -0.7253 5.1099 View CSV PDB
9.0 -0.7007 5.1099 View CSV PDB