Project name: 1f9c263c2642eaa

Status: done

Started: 2026-08-07 08:44:43
Chain sequence(s) A: EVQLQQSGTELMKPGASVKLSCKATGYTFTNYWIEWVKQRPGHGLEWIGEIFPGSGSTNYNENFKGKATFTADTSSNTAYIQLSSLTTEDSAIYYCSRVHYGKYGFFDYWGQGTTLTVSS
B: QIVLTQSPAIMSASPGEKVTMTCSASSSVNYMHWYQQKSGTSPKRWIYDTSKLASGVPARFGGSGSGTSYSLTISDMEAEDAATYYCQQWSSSPPTFGGGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:12)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:13)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:21:33)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1f9c263c2642eaa/tmp/folded.pdb                (00:21:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:30:12)
Show buried residues

Minimal score value
-3.5216
Maximal score value
1.2764
Average score
-0.6526
Total score value
-147.4829

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.0520
2 V A -1.0850
3 Q A -1.7225
4 L A 0.0000
5 Q A -1.9305
6 Q A 0.0000
7 S A -1.0765
8 G A -0.9482
9 T A -0.2246
10 E A -0.1904
11 L A 0.8855
12 M A -0.2674
13 K A -1.6345
14 P A -1.5109
15 G A -1.0946
16 A A -0.8466
17 S A -1.0106
18 V A 0.0000
19 K A -1.8373
20 L A 0.0000
21 S A -0.8305
22 C A 0.0000
23 K A -1.6390
24 A A 0.0000
25 T A -1.2446
26 G A -1.1834
27 Y A -0.6510
28 T A -0.4830
29 F A 0.0000
30 T A -0.8794
31 N A -1.0574
32 Y A -0.1589
33 W A 0.0891
34 I A 0.0000
35 E A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A -0.5837
39 Q A 0.0000
40 R A -1.2731
41 P A -0.9272
42 G A -1.2601
43 H A -1.7011
44 G A -1.2076
45 L A 0.0000
46 E A -1.3247
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 E A 0.0000
51 I A 0.0000
52 F A -0.1987
53 P A 0.0000
54 G A -0.9343
55 S A -0.7219
56 G A -0.6791
57 S A -0.5470
58 T A -0.5397
59 N A -1.2840
60 Y A -1.4687
61 N A 0.0000
62 E A -3.0818
63 N A -2.7164
64 F A -2.0302
65 K A -2.9451
66 G A -1.8329
67 K A -1.5502
68 A A 0.0000
69 T A -0.8264
70 F A 0.0000
71 T A -0.4451
72 A A -0.7247
73 D A -1.2651
74 T A -0.9784
75 S A -0.7207
76 S A -0.9178
77 N A -1.1985
78 T A 0.0000
79 A A 0.0000
80 Y A -0.5500
81 I A 0.0000
82 Q A -1.3144
83 L A 0.0000
84 S A -0.8809
85 S A -0.8251
86 L A 0.0000
87 T A -1.2414
88 T A -1.3463
89 E A -1.9474
90 D A 0.0000
91 S A -0.5690
92 A A 0.0000
93 I A 0.1358
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 S A 0.0000
98 R A 0.0078
99 V A 0.0000
100 H A -0.3882
101 Y A 0.2274
102 G A -0.8091
103 K A -1.6880
104 Y A -0.7109
105 G A 0.0000
106 F A 0.0000
107 F A 0.0000
108 D A -0.3675
109 Y A -0.1850
110 W A -0.6102
111 G A 0.0000
112 Q A -1.5574
113 G A -0.8275
114 T A 0.0000
115 T A -0.0856
116 L A 0.0000
117 T A -0.0958
118 V A 0.0000
119 S A -0.5217
120 S A -0.7212
1 Q B -0.8597
2 I B 0.0000
3 V B 1.2764
4 L B 0.0000
5 T B 0.0983
6 Q B 0.0000
7 S B -0.1029
8 P B 0.1778
9 A B 0.4148
10 I B 1.0234
11 M B 0.1789
12 S B -0.8073
13 A B 0.0000
14 S B -2.0378
15 P B -2.3249
16 G B -2.7713
17 E B -3.4244
18 K B -3.2484
19 V B 0.0000
20 T B -0.6665
21 M B 0.0000
22 T B -0.2756
23 C B 0.0000
24 S B -0.1618
25 A B 0.0000
26 S B 0.0081
27 S B -0.2844
28 S B -0.7209
29 V B 0.0000
30 N B -1.3967
31 Y B -0.5930
32 M B 0.0000
33 H B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 Q B 0.0000
37 Q B -1.3003
38 K B -1.7192
39 S B -0.9167
40 G B -0.9995
41 T B -1.1768
42 S B -1.0687
43 P B 0.0000
44 K B -1.8677
45 R B -0.9270
46 W B -0.7201
47 I B 0.0000
48 Y B -0.7300
49 D B -1.3412
50 T B -1.1110
51 S B -1.2648
52 K B -1.8523
53 L B -0.6772
54 A B 0.0000
55 S B -0.5046
56 G B -0.4039
57 V B -0.2560
58 P B -0.1284
59 A B -0.2903
60 R B -1.1064
61 F B 0.0000
62 G B -0.5126
63 G B -0.7611
64 S B -0.8475
65 G B -0.7783
66 S B -0.7908
67 G B -0.7778
68 T B -0.6502
69 S B -0.6134
70 Y B 0.0000
71 S B -0.3872
72 L B 0.0000
73 T B -0.7900
74 I B 0.0000
75 S B -2.2817
76 D B -3.5216
77 M B 0.0000
78 E B -2.4718
79 A B -1.7549
80 E B -2.3152
81 D B 0.0000
82 A B -1.6296
83 A B -1.2389
84 T B -0.8079
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 Q B 0.0000
89 Q B 0.0000
90 W B 0.0000
91 S B -0.7173
92 S B -0.8426
93 S B -0.7360
94 P B -0.9026
95 P B 0.0000
96 T B -0.1449
97 F B 0.0000
98 G B 0.0000
99 G B -0.8325
100 G B -0.5506
101 T B 0.0000
102 K B -0.9647
103 L B 0.0000
104 E B -1.5994
105 I B -1.3008
106 K B -1.7610
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6626 1.8955 View CSV PDB
4.5 -0.6962 1.8655 View CSV PDB
5.0 -0.737 1.8205 View CSV PDB
5.5 -0.7734 1.772 View CSV PDB
6.0 -0.7923 1.7387 View CSV PDB
6.5 -0.7855 1.7448 View CSV PDB
7.0 -0.7543 1.8049 View CSV PDB
7.5 -0.7076 1.9078 View CSV PDB
8.0 -0.6537 2.0323 View CSV PDB
8.5 -0.5958 2.165 View CSV PDB
9.0 -0.5351 2.3001 View CSV PDB