Project name: 1ff85eaefb51df9

Chain sequence(s)	A: SIIGIIMGILGNIPQVIQIDMSIVKAFKGNK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
pH calculations	Yes
alphaCutter usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[WARNING]    PDB-Info: The input structure is likely a peptide. Results may be inaccurate.         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:24)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/1ff85eaefb51df9/tmp/folded.pdb                (00:00:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)

• Minimal score value: -2.0936
• Maximal score value: 3.3088
• Average score: 0.7797
• Total score value: 23.3901

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan4D score	mutation
1	S	A	1.3417
2	I	A	3.2505
3	I	A	3.3088
4	G	A	2.0542
5	I	A	2.8214
6	I	A	3.0473
7	M	A	2.3232
8	G	A	1.1797
9	I	A	1.6686
10	L	A	1.5560
11	G	A	0.2512
12	N	A	-0.2217
13	I	A	1.1919
14	P	A	0.1637
15	Q	A	-0.4258
16	V	A	0.5893
17	I	A	0.9975
18	Q	A	0.1045
19	I	A	0.8962
20	D	A	0.0000
21	M	A	1.1194
22	S	A	0.3242
23	I	A	1.0903
24	V	A	0.6191
25	K	A	-1.1980
26	A	A	-0.1305
27	F	A	0.9088
28	K	A	-1.6726
29	G	A	-1.6752
30	N	A	-2.0936

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is likely a peptide. Results may be inaccurate. The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH	Average A4D Score	Max A4D Score
4.0	1.5736	4.8988
4.5	1.5753	4.8988
5.0	1.5805	4.8988
5.5	1.595	4.8988
6.0	1.6294	4.8988
6.5	1.691	4.8988
7.0	1.774	4.8988
7.5	1.8676	4.8988
8.0	1.9651	4.8988
8.5	2.0637	4.8988
9.0	2.1619	4.8988