Project name: 20038a44aa8467b

Status: done

Started: 2026-03-12 19:11:12
Chain sequence(s) A: MEPRIQKEYYYNLHENNSQANHNKFHEMPEYDDQLPDFPHKQLEEEQNPFHKLSEVLNSGSVVPLWLVNPIYYVLELFPRAISYYFNGGGGSGGGGSFDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLKDTHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:42)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/20038a44aa8467b/tmp/folded.pdb                (00:02:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:15)
Show buried residues

Minimal score value
-3.9332
Maximal score value
4.1114
Average score
-0.626
Total score value
-149.6094

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A -0.1325
2 E A -1.6032
3 P A -1.3365
4 R A -1.8553
5 I A -0.5026
6 Q A -1.9303
7 K A -2.3096
8 E A -1.5648
9 Y A 0.6252
10 Y A 1.7433
11 Y A 1.7600
12 N A 0.1604
13 L A 0.3238
14 H A -1.8256
15 E A -3.0828
16 N A -3.0809
17 N A -2.9624
18 S A -2.1702
19 Q A -2.2265
20 A A -1.7817
21 N A -2.6433
22 H A -2.5924
23 N A -2.5940
24 K A -2.3296
25 F A -0.1390
26 H A -1.2978
27 E A -1.8417
28 M A -0.2426
29 P A -1.0808
30 E A -1.9978
31 Y A -1.0513
32 D A -2.6885
33 D A -2.7207
34 Q A -1.9032
35 L A -0.0766
36 P A -0.4262
37 D A -0.9318
38 F A 0.6279
39 P A -0.9278
40 H A -1.8414
41 K A -2.4458
42 Q A -2.3188
43 L A -1.2287
44 E A -3.1245
45 E A -3.8315
46 E A -3.9332
47 Q A -3.2126
48 N A -2.2813
49 P A -0.9063
50 F A 0.6507
51 H A -0.9815
52 K A -1.1252
53 L A 0.8454
54 S A -0.1488
55 E A -0.9492
56 V A 1.2743
57 L A 1.2648
58 N A -0.7035
59 S A -0.3716
60 G A 0.1247
61 S A 0.6789
62 V A 2.5350
63 V A 2.9711
64 P A 2.5127
65 L A 3.4526
66 W A 3.1377
67 L A 3.0475
68 V A 2.6765
69 N A 0.8038
70 P A 1.6627
71 I A 3.2782
72 Y A 3.3499
73 Y A 3.5644
74 V A 4.1114
75 L A 3.3197
76 E A 0.8146
77 L A 1.9699
78 F A 2.3231
79 P A 0.3626
80 R A -0.6231
81 A A 1.3408
82 I A 2.1747
83 S A 1.3254
84 Y A 2.0215
85 Y A 2.7028
86 F A 2.3901
87 N A 0.2337
88 G A -0.1934
89 G A -0.8219
90 G A -1.3526
91 G A -1.1922
92 S A -1.2455
93 G A -1.2615
94 G A -1.2037
95 G A -1.1679
96 G A -1.1525
97 S A -1.0273
98 F A -1.1424
99 D A -2.3423
100 A A -1.9618
101 S A -2.1154
102 N A -2.3983
103 F A 0.0000
104 K A -2.1067
105 D A -0.9938
106 F A -0.2960
107 S A -0.5729
108 S A -0.9594
109 I A 0.0000
110 A A -0.3112
111 S A -0.5238
112 A A -0.6332
113 S A -0.5091
114 S A 0.0000
115 S A -0.1293
116 W A 0.0000
117 Q A -0.9887
118 N A 0.0000
119 Q A -1.7279
120 S A -1.1617
121 G A -1.0019
122 S A 0.0000
123 T A -0.6844
124 M A 0.0000
125 I A 0.0305
126 I A 0.0000
127 Q A -1.0109
128 V A 0.0000
129 D A -0.6148
130 S A 0.3494
131 F A 1.1446
132 G A 0.0000
133 N A -0.9687
134 V A 0.0000
135 S A -1.0324
136 G A -0.6375
137 Q A -0.7376
138 Y A 0.0000
139 V A 0.0000
140 N A 0.0000
141 R A -1.7941
142 A A -1.4996
143 Q A -1.7254
144 G A -1.2651
145 T A -0.9332
146 G A -1.1855
147 C A 0.0000
148 Q A -1.7979
149 N A -1.7905
150 S A 0.0000
151 P A -1.0776
152 Y A 0.0000
153 P A -0.8846
154 L A 0.0000
155 T A -0.9180
156 G A -1.1905
157 R A -1.8416
158 V A -0.7231
159 N A -0.8580
160 G A -0.4006
161 T A 0.1938
162 F A 1.2286
163 I A 0.0000
164 A A -0.3842
165 F A 0.0000
166 S A -0.6481
167 V A 0.0000
168 G A -1.1448
169 W A 0.0000
170 N A -2.5687
171 N A -1.6452
172 S A -1.0956
173 T A -1.2828
174 E A -2.0713
175 N A -2.6334
176 C A -1.7691
177 N A -2.2378
178 S A -1.0696
179 A A -0.5139
180 T A 0.0000
181 G A -0.5956
182 W A 0.0000
183 T A -0.0531
184 G A 0.0000
185 Y A 1.1893
186 A A 0.0000
187 Q A -0.5030
188 V A -1.2036
189 N A -1.8060
190 G A -1.6605
191 N A -2.2126
192 N A -1.8139
193 T A 0.0000
194 E A -0.8461
195 I A 0.0000
196 V A 0.2110
197 T A 0.0000
198 S A -0.8869
199 W A -0.9822
200 N A -1.0757
201 L A 0.0000
202 A A -0.1371
203 Y A -0.5578
204 E A -1.8560
205 G A -1.1126
206 G A -1.0616
207 S A -0.8815
208 G A -0.9980
209 P A -0.6598
210 A A 0.0262
211 I A 0.9463
212 E A -0.6130
213 Q A -1.7112
214 G A -1.6542
215 Q A -1.7094
216 D A 0.0000
217 T A -0.7973
218 F A 0.0000
219 Q A -1.3434
220 Y A 0.0000
221 V A 0.2323
222 P A -0.5055
223 T A -0.7379
224 T A -1.5813
225 E A -3.0668
226 N A -2.8149
227 K A -2.3177
228 S A -0.8010
229 L A 0.7799
230 L A 0.7066
231 K A -1.5680
232 D A -2.5733
233 T A -2.0962
234 H A -2.7295
235 H A -2.6974
236 H A -2.6416
237 H A -2.6796
238 H A -2.3808
239 H A -1.8787
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.113 6.0075 View CSV PDB
4.5 -0.1868 6.0075 View CSV PDB
5.0 -0.2736 6.0075 View CSV PDB
5.5 -0.3545 6.0075 View CSV PDB
6.0 -0.4094 6.0075 View CSV PDB
6.5 -0.4289 6.0075 View CSV PDB
7.0 -0.4228 6.0075 View CSV PDB
7.5 -0.4072 6.0075 View CSV PDB
8.0 -0.3881 6.0075 View CSV PDB
8.5 -0.3645 6.0075 View CSV PDB
9.0 -0.335 6.0075 View CSV PDB