Project name: 5B5 MUTANT ANTIBODY 6

Status: done

Started: 2026-03-17 05:32:35
Chain sequence(s) A: DIVMTQTPLSLSVTPGQPASISCRSSQSLVHSNGKTYLEWYLQKPGQSPQLLIYKLSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGSGTKLEIKGGGGSGGGGSGGGGSVQLVQSGAEVKKPGASVKVSCKASGYTFTDYIMLWVRQAPGQGLEWMGNIDPYYGSTGYALKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDGNYGSDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:00)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:50)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/201fd3a83c6fe37/tmp/folded.pdb                (00:02:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:43)
Show buried residues

Minimal score value
-3.1433
Maximal score value
1.6768
Average score
-0.6423
Total score value
-156.0739

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.0253
2 I A 0.0000
3 V A 0.7693
4 M A 0.0000
5 T A -0.2787
6 Q A 0.0000
7 T A 0.0105
8 P A 0.4619
9 L A 1.2312
10 S A 0.0662
11 L A -0.3351
12 S A -1.2267
13 V A 0.0000
14 T A -1.6353
15 P A -1.8055
16 G A -1.6525
17 Q A -1.8234
18 P A -1.9511
19 A A 0.0000
20 S A -0.8538
21 I A 0.0000
22 S A -0.8960
23 C A 0.0000
24 R A -2.2743
25 S A 0.0000
26 S A -0.9811
27 Q A -1.5651
28 S A -0.9502
29 L A 0.0000
30 V A -0.1769
31 H A -0.9083
32 S A -0.9945
33 N A -1.6208
34 G A -1.3955
35 K A -1.7119
36 T A -0.7969
37 Y A -0.3518
38 L A 0.0000
39 E A -0.3750
40 W A 0.0000
41 Y A 0.0000
42 L A 0.0000
43 Q A 0.0000
44 K A -1.5287
45 P A -1.0482
46 G A -1.4807
47 Q A -2.0410
48 S A -1.2010
49 P A 0.0000
50 Q A -0.9797
51 L A 0.0000
52 L A 0.0000
53 I A 0.0000
54 Y A -0.7269
55 K A -1.2176
56 L A -0.8842
57 S A -1.0031
58 N A -1.3052
59 R A -1.8004
60 A A 0.0000
61 S A -0.6517
62 G A -1.0275
63 V A -1.0532
64 P A -1.3114
65 D A -2.4173
66 R A -2.2912
67 F A 0.0000
68 S A -1.5283
69 G A 0.0000
70 S A -0.9952
71 G A -1.0128
72 S A -0.7387
73 G A -0.7314
74 T A -1.4743
75 D A -2.0782
76 F A 0.0000
77 T A -1.1303
78 L A 0.0000
79 K A -2.0882
80 I A 0.0000
81 S A -2.3154
82 R A -3.1433
83 V A 0.0000
84 E A -2.4108
85 A A -1.8664
86 E A -2.3937
87 D A 0.0000
88 V A -1.1660
89 G A 0.0000
90 V A -0.0786
91 Y A 0.0000
92 Y A 0.0000
93 C A 0.0000
94 F A 0.0000
95 Q A 0.0000
96 G A 0.2099
97 S A 0.0000
98 H A 0.1028
99 V A 1.4850
100 P A 0.0000
101 F A 0.7316
102 T A 0.3893
103 F A 0.3410
104 G A 0.0000
105 S A -0.0193
106 G A 0.0000
107 T A 0.0000
108 K A -0.6159
109 L A 0.0000
110 E A -1.9771
111 I A -2.0309
112 K A -2.4612
113 G A -1.8244
114 G A -1.7149
115 G A -1.3238
116 G A -1.7301
117 S A -1.2486
118 G A -1.6270
119 G A -1.6241
120 G A -1.7696
121 G A -1.6708
122 S A -1.0811
123 G A -1.3330
124 G A -1.2251
125 G A -1.1869
126 G A -1.0036
127 S A -0.8926
128 V A -0.7857
129 Q A -1.2123
130 L A 0.0000
131 V A 0.4056
132 Q A 0.0000
133 S A -0.5719
134 G A -0.6132
135 A A -0.0809
136 E A -0.2249
137 V A 0.8718
138 K A -0.8971
139 K A -2.0827
140 P A -2.0611
141 G A -1.4522
142 A A -1.1626
143 S A -1.3279
144 V A 0.0000
145 K A -2.1097
146 V A 0.0000
147 S A -0.6279
148 C A 0.0000
149 K A -0.8164
150 A A 0.0000
151 S A -0.6734
152 G A -0.7705
153 Y A -0.4994
154 T A -0.5820
155 F A 0.0000
156 T A -0.1224
157 D A -1.4123
158 Y A -0.6580
159 I A 0.0749
160 M A 0.0000
161 L A 0.0000
162 W A 0.0000
163 V A 0.0000
164 R A 0.0000
165 Q A -0.5789
166 A A -1.0118
167 P A -1.0228
168 G A -1.2140
169 Q A -1.6854
170 G A -0.9632
171 L A 0.0000
172 E A -0.5243
173 W A 0.0000
174 M A 0.0000
175 G A 0.0000
176 N A -0.3204
177 I A 0.0000
178 D A 0.1189
179 P A 0.0000
180 Y A 1.3896
181 Y A 1.6768
182 G A 0.3748
183 S A 0.1144
184 T A -0.1460
185 G A 0.0476
186 Y A 0.1249
187 A A 0.0000
188 L A 0.2442
189 K A -1.3739
190 F A 0.0000
191 Q A -1.4327
192 G A -1.2440
193 R A -1.2447
194 V A 0.0000
195 T A -0.8352
196 M A 0.0000
197 T A -0.6622
198 R A -0.8928
199 D A -1.1920
200 T A -0.5033
201 S A -0.5457
202 T A -0.6367
203 S A -0.7238
204 T A 0.0000
205 V A 0.0000
206 Y A -0.8390
207 M A 0.0000
208 E A -1.5527
209 L A 0.0000
210 S A -1.0906
211 S A -1.1004
212 L A 0.0000
213 R A -2.5964
214 S A -2.1626
215 E A -2.4100
216 D A 0.0000
217 T A -0.8237
218 A A 0.0000
219 V A 0.2300
220 Y A 0.0000
221 Y A 0.0000
222 C A 0.0000
223 A A 0.0000
224 R A 0.0000
225 D A -1.2369
226 G A -1.0852
227 N A -1.2247
228 Y A -0.6833
229 G A -0.6120
230 S A 0.0000
231 D A -0.5781
232 Y A -0.3759
233 W A -0.4053
234 G A 0.0000
235 Q A -1.2415
236 G A -0.5286
237 T A 0.0000
238 T A 0.0115
239 V A 0.0000
240 T A -0.2845
241 V A 0.0000
242 S A -1.0321
243 S A -1.1295
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6399 1.9766 View CSV PDB
4.5 -0.6758 1.8854 View CSV PDB
5.0 -0.7168 1.7756 View CSV PDB
5.5 -0.7542 1.6577 View CSV PDB
6.0 -0.7796 1.628 View CSV PDB
6.5 -0.7882 1.6089 View CSV PDB
7.0 -0.7811 1.59 View CSV PDB
7.5 -0.7635 1.5716 View CSV PDB
8.0 -0.74 1.5548 View CSV PDB
8.5 -0.7116 1.5442 View CSV PDB
9.0 -0.6776 1.5972 View CSV PDB