Project name: mi2699_2VY0_25C_conf4

Status: done

Started: 2026-05-22 14:59:19
Chain sequence(s) A: VPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:08:56)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/20393e83fac9592/tmp/folded.pdb                (00:08:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:14:37)
Show buried residues

Minimal score value
-3.2608
Maximal score value
1.7932
Average score
-0.6585
Total score value
-173.195

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
35 V A 1.3770
36 P A 0.0664
37 E A -0.9972
38 V A -0.1680
39 I A -0.6917
40 E A -2.0216
41 I A -1.2674
42 D A -1.4581
43 G A -1.6346
44 K A -1.5443
45 Q A -1.4534
46 W A 0.0000
47 R A -0.7558
48 L A 0.4294
49 I A 1.2666
50 W A 0.0000
51 H A 0.0660
52 D A -0.8933
53 E A -1.0222
54 F A 0.0000
55 E A -2.5912
56 G A -2.0192
57 S A -1.5645
58 E A -2.2611
59 V A -1.9138
60 N A -2.1828
61 K A -2.9880
62 E A -2.8602
63 Y A -1.8376
64 W A 0.0000
65 T A -1.4954
66 F A -1.1136
67 E A -1.3897
68 K A -2.0605
69 G A 0.0000
70 N A -0.1278
71 G A 0.0000
72 I A 1.1014
73 A A 0.7445
74 Y A 1.6789
75 G A 0.9333
76 I A 1.1383
77 P A 0.2246
78 G A 0.0000
79 W A 0.0719
80 G A -0.5316
81 N A -1.2441
82 G A 0.0000
83 E A -0.5973
84 L A 0.0324
85 E A 0.0000
86 Y A 0.0000
87 Y A 0.0000
88 T A 0.0000
89 E A -2.5050
90 N A -2.0263
91 N A 0.0000
92 T A 0.0000
93 Y A -0.2944
94 I A 0.0000
95 V A -0.3588
96 N A -1.3902
97 G A -1.4699
98 T A -0.7754
99 L A 0.0000
100 V A 0.0000
101 I A 0.0000
102 E A -0.7200
103 A A 0.0000
104 R A -1.3775
105 K A -1.5808
106 E A -1.0239
107 I A 1.7932
108 I A 1.7700
109 T A 0.5874
110 D A -0.8553
111 P A -1.2316
112 N A -1.5262
113 E A 0.0000
114 G A -0.4357
115 T A 0.6228
116 F A 0.9818
117 L A 1.2145
118 Y A 0.0000
119 T A 0.0000
120 S A 0.0000
121 S A 0.0000
122 R A -0.8803
123 L A 0.0000
124 K A -0.4446
125 T A 0.0000
126 E A -1.1516
127 G A -1.5527
128 K A -2.2797
129 V A -1.5335
130 E A -2.0780
131 F A 0.0000
132 S A -1.4201
133 P A 0.0000
134 P A -0.1938
135 V A 0.0000
136 V A 0.0000
137 V A 0.0000
138 E A -0.6743
139 A A 0.0000
140 R A -1.0779
141 I A 0.0000
142 K A -1.4872
143 L A 0.0000
144 P A -1.4984
145 K A -2.4955
146 G A -1.9197
147 K A -2.2442
148 G A 0.0000
149 L A 0.0000
150 W A 0.1578
151 P A 0.0000
152 A A 0.0000
153 F A 0.0000
154 W A -0.0474
155 M A 0.0000
156 L A 0.0000
157 G A 0.0000
158 S A -1.2716
159 N A -1.2898
160 I A -0.9964
161 R A -2.2750
162 E A -2.2662
163 V A -0.5121
164 G A -0.4103
165 W A 0.4550
166 P A 0.0665
167 N A -1.0016
168 C A 0.0000
169 G A 0.0000
170 E A -0.3134
171 I A 0.0000
172 D A -0.3902
173 I A 0.0000
174 M A 0.0000
175 E A -0.3434
176 F A 0.0000
177 L A -0.6220
178 G A 0.0000
179 H A -1.9561
180 E A -2.1408
181 P A -1.7912
182 R A -1.3008
183 T A -0.7745
184 I A 0.0000
185 H A -1.1340
186 G A 0.0000
187 T A 0.0000
188 V A 0.0000
189 H A -0.7614
190 G A 0.0000
191 P A -0.9346
192 G A -1.0751
193 Y A 0.0000
194 S A -1.0163
195 G A -1.2069
196 S A -1.2499
197 K A -2.0155
198 G A -1.1057
199 I A -0.7558
200 T A -1.5219
201 R A -2.1836
202 A A -1.1133
203 Y A -0.3706
204 T A -0.7800
205 L A 0.0000
206 P A -1.1478
207 E A -2.0619
208 G A -1.1492
209 V A -0.6801
210 P A -1.2335
211 D A -1.6975
212 F A 0.0000
213 T A -2.0529
214 E A -2.7162
215 D A -2.0366
216 F A -1.1734
217 H A 0.0000
218 V A -1.0129
219 F A 0.0000
220 G A 0.0000
221 I A 0.0000
222 V A 0.0000
223 W A 0.0000
224 Y A -0.6781
225 P A -1.6715
226 D A -1.8539
227 K A -1.9205
228 I A 0.0000
229 K A -1.1551
230 W A 0.0000
231 Y A 0.0000
232 V A 0.0000
233 D A -1.9181
234 G A -1.0899
235 T A -0.3347
236 F A 0.0904
237 Y A -0.2779
238 H A -1.3832
239 E A -2.1354
240 V A 0.0000
241 T A -2.2928
242 K A -2.9483
243 E A -3.2608
244 Q A -2.5597
245 V A 0.0000
246 E A -3.1010
247 A A -1.7108
248 M A -0.8355
249 G A -1.1423
250 Y A -1.4049
251 E A -2.3316
252 W A 0.0000
253 V A -1.4289
254 F A 0.0000
255 D A -2.7685
256 K A -2.3485
257 P A -1.7597
258 F A 0.0000
259 Y A 0.0000
260 I A 0.0000
261 I A 0.0000
262 L A 0.0000
263 N A 0.0000
264 L A 0.0000
265 A A 0.1571
266 V A 0.0000
267 G A 0.0000
268 G A 0.3594
269 Y A 1.3094
270 W A 1.5447
271 P A 0.2717
272 G A -0.1640
273 N A -1.3951
274 P A -1.7529
275 D A -2.1697
276 A A -1.0015
277 T A -0.6713
278 T A 0.0000
279 P A -0.8321
280 F A -0.4809
281 P A -0.9518
282 A A 0.0000
283 K A -1.2177
284 M A 0.0000
285 V A -0.2377
286 V A 0.0000
287 D A -0.9631
288 Y A -0.8295
289 V A 0.0000
290 R A -0.0676
291 V A 0.0000
292 Y A 0.0000
293 S A 0.6771
294 F A 0.6901
295 V A 0.5761
296 S A -0.5231
297 G A -1.0032
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.2377 4.224 View CSV PDB
4.5 -0.3088 4.224 View CSV PDB
5.0 -0.4014 4.224 View CSV PDB
5.5 -0.4975 4.224 View CSV PDB
6.0 -0.5778 4.224 View CSV PDB
6.5 -0.6276 4.224 View CSV PDB
7.0 -0.6438 4.2239 View CSV PDB
7.5 -0.6356 4.2239 View CSV PDB
8.0 -0.6144 4.2236 View CSV PDB
8.5 -0.5864 4.2229 View CSV PDB
9.0 -0.553 4.2207 View CSV PDB