Project name: 205e45a4f140852

Status: done

Started: 2026-07-22 14:17:14
Chain sequence(s) A: DIQMTQSPSSVSASVGDRVTITCHASQNINVWLTWYQQKPGKAPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQGQSYPWTFGGGTKVEIK
B: QVQLQESGPGLVRPSETLSLTCIVSGFSLTGYGVNWIRQPPGKGLEWIGMIWVDGSTDYNSALKSRVTISVDTSKNQFSLKLNSVTAADTAVYYCARGGYGAMDYWGQGTLVTVSSSSA
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:22)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/205e45a4f140852/tmp/folded.pdb                (00:01:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:26)
Show buried residues

Minimal score value
-2.7575
Maximal score value
1.2788
Average score
-0.5696
Total score value
-128.7358

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -2.0902
2 I A -1.7624
3 Q A -1.9394
4 M A 0.0000
5 T A -0.9099
6 Q A 0.0000
7 S A -0.5791
8 P A -0.5501
9 S A -0.7716
10 S A -0.9498
11 V A -0.4405
12 S A -0.6634
13 A A 0.0000
14 S A -0.2284
15 V A 0.3609
16 G A -0.7971
17 D A -1.5959
18 R A -2.2531
19 V A 0.0000
20 T A -0.6072
21 I A 0.0000
22 T A -0.6781
23 C A 0.0000
24 H A -1.8658
25 A A 0.0000
26 S A -1.9285
27 Q A -2.7575
28 N A -2.5537
29 I A 0.0000
30 N A -1.9414
31 V A -0.7109
32 W A -0.1615
33 L A 0.0000
34 T A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.7671
40 P A -1.3240
41 G A -1.6731
42 K A -2.5910
43 A A -1.5702
44 P A 0.0000
45 K A -1.3771
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.1995
50 K A -0.5901
51 A A 0.0000
52 S A -0.5483
53 N A -0.5321
54 L A 0.0342
55 H A -0.2609
56 T A -0.3563
57 G A -0.4959
58 V A 0.0000
59 P A -0.3703
60 S A -0.4256
61 R A -0.7345
62 F A 0.0000
63 S A -0.4025
64 G A -0.4492
65 S A -0.8976
66 G A -1.2970
67 S A -1.3978
68 G A -1.8307
69 T A -2.1560
70 D A -2.6049
71 F A 0.0000
72 T A -0.7567
73 L A 0.0000
74 T A -0.6165
75 I A 0.0000
76 S A -1.2943
77 S A -1.1270
78 L A 0.0000
79 Q A -0.9211
80 P A -0.6770
81 E A -1.8808
82 D A 0.0000
83 F A -0.4484
84 A A 0.0000
85 T A -1.0403
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 G A 0.1142
92 Q A -0.6832
93 S A -0.2169
94 Y A 0.1560
95 P A 0.0000
96 W A 0.0000
97 T A -0.5610
98 F A -0.2658
99 G A 0.0000
100 G A -1.1076
101 G A -0.9733
102 T A 0.0000
103 K A -1.6672
104 V A 0.0000
105 E A -0.8468
106 I A 0.7565
107 K A -0.8311
1 Q B -1.4766
2 V B -0.8634
3 Q B -1.5154
4 L B 0.0000
5 Q B -1.3311
6 E B 0.0000
7 S B -0.5690
8 G B -0.4970
9 P B -0.2688
10 G B 0.0373
11 L B -0.0778
12 V B 0.0000
13 R B -2.5464
14 P B -1.8220
15 S B -1.8421
16 E B -2.7130
17 T B -1.9100
18 L B 0.0000
19 S B -0.9946
20 L B 0.0000
21 T B -0.4558
22 C B 0.0000
23 I B -0.6745
24 V B 0.0000
25 S B -1.1362
26 G B -1.0334
27 F B -0.3137
28 S B -0.1176
29 L B 0.1659
30 T B -0.1010
31 G B 0.1577
32 Y B 0.6748
33 G B 0.0000
34 V B 0.0000
35 N B 0.0000
36 W B 0.0000
37 I B 0.0000
38 R B 0.0000
39 Q B -0.6409
40 P B -0.7795
41 P B -0.8642
42 G B -1.5124
43 K B -2.2735
44 G B -1.4026
45 L B 0.0000
46 E B -0.7435
47 W B 0.0000
48 I B 0.0000
49 G B 0.0000
50 M B 0.0000
51 I B 0.0000
52 W B -0.2130
53 V B -0.3940
54 D B -1.6720
55 G B -1.0245
56 S B -0.7405
57 T B -0.5375
58 D B -0.5662
59 Y B -0.4623
60 N B 0.0000
61 S B -0.9652
62 A B -0.5310
63 L B 0.0000
64 K B -1.8330
65 S B -1.2175
66 R B -1.4078
67 V B 0.0000
68 T B -0.9185
69 I B 0.0000
70 S B -0.3969
71 V B -0.7858
72 D B -1.5523
73 T B -1.3819
74 S B -1.4239
75 K B -2.2414
76 N B -1.4261
77 Q B -1.3116
78 F B 0.0000
79 S B -0.5110
80 L B 0.0000
81 K B -1.4091
82 L B 0.0000
83 N B -1.6553
84 S B -1.5115
85 V B 0.0000
86 T B -0.8108
87 A B -0.2748
88 A B 0.0392
89 D B 0.0000
90 T B 0.2607
91 A B 0.0000
92 V B 0.6099
93 Y B 0.0000
94 Y B 0.0000
95 C B 0.0000
96 A B 0.0000
97 R B 0.0000
98 G B 0.0000
99 G B 0.0000
100 Y B 1.2788
101 G B 0.0000
102 A B 0.4150
103 M B 0.0000
104 D B -0.1729
105 Y B 0.0134
106 W B -0.6261
107 G B 0.0000
108 Q B -1.7304
109 G B 0.0000
110 T B 0.1829
111 L B 1.2334
112 V B 0.0000
113 T B 0.0578
114 V B 0.0000
115 S B -0.8103
116 S B -0.9970
117 S B -0.6494
118 S B -0.4886
119 A B -0.0551
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6007 2.2042 View CSV PDB
4.5 -0.6302 2.2042 View CSV PDB
5.0 -0.6638 2.2042 View CSV PDB
5.5 -0.6947 2.2042 View CSV PDB
6.0 -0.7146 2.2042 View CSV PDB
6.5 -0.718 2.2042 View CSV PDB
7.0 -0.7062 2.2042 View CSV PDB
7.5 -0.6847 2.2042 View CSV PDB
8.0 -0.6573 2.2042 View CSV PDB
8.5 -0.6252 2.2042 View CSV PDB
9.0 -0.5886 2.2042 View CSV PDB