Project name: AlaAla_R2

Status: done

Started: 2026-08-20 07:36:04
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYAHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:48)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/20d749c213772f/tmp/folded.pdb                 (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:47)
Show buried residues

Minimal score value
-2.6083
Maximal score value
2.0185
Average score
-0.5179
Total score value
-128.4298

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6120
2 V A -1.3086
3 Q A -1.9723
4 L A 0.0000
5 Q A -1.8557
6 E A 0.0000
7 S A -0.6488
8 G A -0.3559
9 P A -0.0769
10 G A 0.4273
11 L A 0.7645
12 V A 0.0000
13 K A -1.5732
14 P A -1.3267
15 S A -1.2980
16 Q A -1.7578
17 T A -1.4281
18 L A 0.0000
19 S A -0.8982
20 L A 0.0000
21 T A -0.6359
22 A A 0.0000
23 T A -1.2411
24 V A 0.0000
25 S A -1.3365
26 G A -1.3455
27 G A -1.0318
28 S A -0.6793
29 I A 0.0000
30 S A -0.2024
31 S A -0.2305
32 G A -0.0130
33 D A 0.2203
34 Y A 0.7191
35 Y A 0.6490
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6633
43 P A -0.6608
44 G A -1.1262
45 C A -1.2090
46 K A -2.0222
47 G A -1.2099
48 L A 0.0000
49 E A -0.7138
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1223
54 I A 0.0000
55 Y A 0.3700
56 Y A 0.4117
57 S A -0.0031
58 G A -0.2201
59 S A -0.2533
60 T A -0.2586
61 D A -0.7355
62 Y A -0.7358
63 N A -0.9372
64 P A -1.1592
65 S A -0.9244
66 L A 0.0000
67 K A -2.1038
68 S A -1.3914
69 R A -1.5502
70 V A 0.0000
71 T A -0.9922
72 M A 0.0000
73 S A -0.3428
74 V A -0.3385
75 D A -1.1698
76 T A -1.0074
77 S A -1.3302
78 K A -2.1755
79 N A -1.4467
80 Q A -1.2621
81 F A 0.0000
82 S A -0.4863
83 L A 0.0000
84 K A -1.3548
85 V A 0.0000
86 N A -1.5534
87 S A -1.3895
88 V A 0.0000
89 T A -0.6104
90 A A -0.2111
91 A A -0.0323
92 D A 0.0000
93 T A 0.2907
94 A A 0.0000
95 V A 0.3223
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.8127
103 I A 1.5508
104 F A 2.0185
105 G A 0.9181
106 V A 0.8462
107 G A 0.6785
108 T A 0.0000
109 F A 0.0000
110 D A -0.4814
111 Y A -0.4248
112 W A -0.7958
113 G A 0.0000
114 Q A -1.6591
115 G A -0.7227
116 T A -0.1013
117 L A 0.9513
118 V A 0.0000
119 T A 0.3410
120 V A 0.0000
121 S A -0.3377
122 S A -0.5795
123 A A -0.4762
124 A A -0.3494
125 G A -0.8383
126 G A -1.0742
127 G A -1.1308
128 G A -1.1746
129 S A -1.0263
130 G A -1.1700
131 G A -1.2054
132 G A -1.1745
133 G A -1.2100
134 S A -1.0083
135 G A -1.1655
136 G A -1.3320
137 G A -1.2404
138 G A -1.2584
139 S A -0.9554
140 D A -0.9852
141 I A 0.0000
142 V A 0.9348
143 M A 0.0000
144 T A -0.6148
145 Q A -0.8402
146 S A -0.7236
147 P A -0.3446
148 A A -0.3679
149 T A -0.4778
150 L A -0.1925
151 S A -0.3323
152 L A -0.6726
153 S A -1.0119
154 P A -1.4952
155 G A -1.8359
156 E A -2.4501
157 R A -2.6083
158 A A 0.0000
159 T A -0.6549
160 L A 0.0000
161 S A -0.8791
162 A A 0.0000
163 R A -2.3796
164 A A 0.0000
165 S A -0.9332
166 Q A -1.6354
167 S A -1.2426
168 V A 0.0000
169 S A -0.4037
170 S A -0.0743
171 Y A 0.8160
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4505
179 P A -0.9646
180 G A -0.9716
181 C A -1.1127
182 Q A -1.5454
183 A A -1.1522
184 P A 0.0000
185 R A -1.3861
186 L A -0.6124
187 L A 0.0000
188 I A 0.0000
189 Y A -0.1649
190 D A -0.2946
191 A A 0.0000
192 S A -0.8640
193 N A -1.2728
194 R A -1.4159
195 A A -0.9276
196 T A -0.5928
197 G A -0.6608
198 I A 0.0000
199 P A -0.4396
200 A A -0.3721
201 R A -0.7060
202 F A 0.0000
203 S A -0.6658
204 G A 0.0000
205 S A -0.7763
206 G A -1.1104
207 S A -0.9266
208 G A -1.0549
209 T A -1.7842
210 D A -2.2232
211 F A 0.0000
212 T A -0.7737
213 L A 0.0000
214 T A -0.5834
215 I A 0.0000
216 S A -1.3612
217 S A -1.7548
218 L A 0.0000
219 E A -2.0289
220 P A -1.4039
221 E A -2.1658
222 D A 0.0000
223 F A -0.6719
224 A A 0.0000
225 V A -0.6480
226 Y A 0.0000
227 Y A 0.0000
228 A A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3334
232 G A 0.0826
233 S A -0.2326
234 T A -0.4192
235 P A 0.0000
236 L A 0.0000
237 T A 0.1691
238 F A 0.2500
239 G A 0.0000
240 G A -0.8200
241 G A -0.7858
242 T A 0.0000
243 K A -0.9206
244 A A 0.0000
245 E A -0.4327
246 I A 0.7146
247 K A -0.8871
248 A A -0.3503
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.467 4.8712 View CSV PDB
4.5 -0.4869 4.8686 View CSV PDB
5.0 -0.5096 4.8616 View CSV PDB
5.5 -0.5299 4.8463 View CSV PDB
6.0 -0.5416 4.8214 View CSV PDB
6.5 -0.5402 4.79 View CSV PDB
7.0 -0.5261 4.7557 View CSV PDB
7.5 -0.5039 4.7204 View CSV PDB
8.0 -0.4771 4.6848 View CSV PDB
8.5 -0.4473 4.6492 View CSV PDB
9.0 -0.415 4.6137 View CSV PDB