Project name: 23fdb572a049952 [mutate: FE161A, FE164A]

Status: done

Started: 2026-04-12 20:46:36
Chain sequence(s) A: MSSIGMDIRDFFAQSAGRWFSQRTSHHLAFKQSESGKSQLTIELLSVDDPAVIALCQQCDTDPARAVCGARVSWDSTMECDNEKHEGSTVLVPIMDQGSRMEGKLLHELGYAEKSPLAGRFSMGRDGALTLITEYETIYIEERFWFASPNLRLRASILKRFGGFSMASFCSEIRLGVTQPANS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues FE164A,FE161A
Energy difference between WT (input) and mutated protein (by FoldX) 1.3834 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:09)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:26)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/21917269f1f759e/tmp/folded.pdb                (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:09)
Show buried residues
Minimal score value
-4.4459
Maximal score value
1.6382
Average score
-1.0502
Total score value
-192.1885
Download the table (csv)

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.2099
2 S A 0.7660
3 S A 0.8842
4 I A 1.6382
5 G A -0.4724
6 M A -1.2921
7 D A -1.7951
8 I A 0.0000
9 R A -2.6055
10 D A -2.7737
11 F A 0.0000
12 F A 0.0000
13 A A -1.3046
14 Q A -1.0688
15 S A 0.0000
16 A A -1.0222
17 G A -1.3301
18 R A -1.8338
19 W A 0.0000
20 F A -0.0610
21 S A 0.0000
22 Q A -1.0359
23 R A -1.1581
24 T A -0.7461
25 S A 0.0000
26 H A -1.0305
27 H A -0.8958
28 L A -0.4215
29 A A 0.1150
30 F A 0.7113
31 K A -1.3884
32 Q A -1.7903
33 S A -1.5916
34 E A -1.8118
35 S A -1.3494
36 G A 0.0000
37 K A -1.6901
38 S A -1.7282
39 Q A -1.6606
40 L A -1.1741
41 T A -1.3315
42 I A 0.0000
43 E A -1.2992
44 L A -0.3054
45 L A -0.3065
46 S A -0.5486
47 V A -0.6209
48 D A -1.7441
49 D A -1.0957
50 P A -0.6122
51 A A -0.5464
52 V A 0.0000
53 I A -0.6358
54 A A -0.8333
55 L A 0.0000
56 C A 0.0000
57 Q A -2.6384
58 Q A -2.4097
59 C A -2.1696
60 D A -2.9667
61 T A -2.5020
62 D A -2.8397
63 P A -1.8848
64 A A -1.3787
65 R A -2.2674
66 A A 0.0000
67 V A -0.3702
68 C A 0.0000
69 G A 0.0000
70 A A 0.0000
71 R A -0.9430
72 V A -0.5013
73 S A -1.1537
74 W A -1.4501
75 D A -2.7568
76 S A 0.0000
77 T A -2.9916
78 M A -2.5886
79 E A -2.6973
80 C A -1.6440
81 D A -3.5635
82 N A -3.7438
83 E A -4.4459
84 K A -4.3493
85 H A -3.7397
86 E A -3.4696
87 G A -1.5740
88 S A -1.0137
89 T A 0.0000
90 V A -0.5701
91 L A -0.1782
92 V A 0.0000
93 P A 0.0000
94 I A 0.0000
95 M A -2.2314
96 D A -2.9773
97 Q A -2.5475
98 G A -1.8777
99 S A -2.1510
100 R A -2.5653
101 M A -2.0065
102 E A -2.5606
103 G A 0.0000
104 K A -2.1687
105 L A 0.0000
106 L A 0.0000
107 H A -0.9610
108 E A -1.9409
109 L A -0.9724
110 G A -0.6477
111 Y A 0.3634
112 A A -0.4727
113 E A -2.0060
114 K A -2.3400
115 S A -1.8042
116 P A -1.4139
117 L A -0.9683
118 A A -0.9072
119 G A -1.3618
120 R A -2.3677
121 F A 0.0000
122 S A -1.4077
123 M A 0.0000
124 G A -1.7768
125 R A -2.6176
126 D A -2.7204
127 G A -1.7072
128 A A 0.0000
129 L A 0.0000
130 T A -0.7445
131 L A -0.8156
132 I A -1.0026
133 T A -1.0714
134 E A -1.9998
135 Y A -1.2793
136 E A -2.3047
137 T A -2.1204
138 I A -1.5070
139 Y A -1.4223
140 I A -0.4319
141 E A -0.9529
142 E A -0.5768
143 R A -0.7187
144 F A -0.0872
145 W A 0.0715
146 F A 0.1865
147 A A 0.2741
148 S A 0.0752
149 P A -0.2705
150 N A 0.0412
151 L A 0.5574
152 R A 0.0000
153 L A 0.4766
154 R A -0.1176
155 A A -0.0278
156 S A 0.0836
157 I A -0.1211
158 L A -0.7719
159 K A -2.3314
160 R A -2.7917
161 E A -3.1889 mutated: FE161A
162 G A -2.2943
163 G A -2.3065
164 E A -2.4841 mutated: FE164A
165 S A -1.2483
166 M A -0.6474
167 A A -0.0825
168 S A 0.1745
169 F A 0.6875
170 C A 0.0000
171 S A 0.1582
172 E A 0.0000
173 I A 0.6782
174 R A -0.0419
175 L A 0.0061
176 G A -0.3272
177 V A 0.1806
178 T A -0.3044
179 Q A -1.3085
180 P A -1.1299
181 A A -1.0312
182 N A -1.6170
183 S A -0.8563
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6703 2.2737 View CSV PDB
4.5 -0.7705 2.2239 View CSV PDB
5.0 -0.9008 2.2239 View CSV PDB
5.5 -1.0408 2.2239 View CSV PDB
6.0 -1.169 2.2849 View CSV PDB
6.5 -1.2688 2.4664 View CSV PDB
7.0 -1.3333 2.6906 View CSV PDB
7.5 -1.3692 2.9308 View CSV PDB
8.0 -1.3872 3.1753 View CSV PDB
8.5 -1.3924 3.4205 View CSV PDB
9.0 -1.3842 3.6639 View CSV PDB