Project name: A493

Status: done

Started: 2025-04-25 18:44:17
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGGTFVEYAISWVRQAPGQGLEWMGGIIPAFGTAQYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGAGYYGDKDPMDVWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVLHTITFGGGTKVEIK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:19)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/21cbb446385ad2e/tmp/folded.pdb                (00:02:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:44)
Show buried residues

Minimal score value
-2.9566
Maximal score value
1.911
Average score
-0.6739
Total score value
-167.1187

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5333
2 V A -1.0249
3 Q A -1.4410
4 L A 0.0000
5 V A -0.0321
6 Q A 0.0000
7 S A -0.7200
8 G A -0.6841
9 A A -0.1678
10 E A -0.3739
11 V A 0.5830
12 K A -1.2329
13 K A -2.4766
14 P A -2.3079
15 G A -1.5534
16 S A -1.2457
17 S A -1.2909
18 V A 0.0000
19 K A -1.9805
20 V A 0.0000
21 S A -0.6446
22 C A 0.0000
23 K A -1.5146
24 A A -1.1790
25 S A -1.1742
26 G A -1.2685
27 G A -1.0760
28 T A -0.7751
29 F A 0.0000
30 V A -0.1164
31 E A -1.0212
32 Y A 0.0394
33 A A 0.3707
34 I A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.5856
40 A A -1.0193
41 P A -1.0405
42 G A -1.2155
43 Q A -1.7358
44 G A -1.0832
45 L A 0.0000
46 E A -0.5796
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 G A -0.2820
51 I A 0.0000
52 I A 0.6168
53 P A 0.0000
54 A A 0.4872
55 F A 1.9110
56 G A 0.3632
57 T A 0.2093
58 A A -0.1820
59 Q A -1.1395
60 Y A -1.2269
61 A A -1.6749
62 Q A -2.7572
63 K A -2.9501
64 F A 0.0000
65 Q A -2.4109
66 G A -1.5346
67 R A -1.1569
68 V A 0.0000
69 T A -0.7702
70 I A 0.0000
71 T A -0.2077
72 A A -0.6294
73 D A -1.6476
74 E A -2.2726
75 S A -1.3092
76 T A -1.2242
77 S A -1.4153
78 T A 0.0000
79 A A 0.0000
80 Y A -0.5513
81 M A 0.0000
82 E A -1.2203
83 L A 0.0000
84 S A -1.0274
85 S A -1.1245
86 L A 0.0000
87 R A -2.9566
88 S A -2.4285
89 E A -2.6190
90 D A 0.0000
91 T A -0.8736
92 A A 0.0000
93 V A 0.1225
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.2174
99 G A -0.4794
100 A A -0.1761
101 G A -0.1333
102 Y A 0.7815
103 Y A 0.9041
104 G A -0.4061
105 D A -1.5476
106 K A -1.4574
107 D A -1.3110
108 P A 0.0000
109 M A 0.0000
110 D A -0.8632
111 V A -0.5408
112 W A 0.0000
113 G A 0.0000
114 Q A -1.4708
115 G A -0.7663
116 T A 0.0000
117 T A -0.0259
118 V A 0.0000
119 T A -0.4673
120 V A 0.0000
121 S A -1.5497
122 S A -0.6626
123 G A 0.0000
124 G A -1.0219
125 G A -1.2885
126 G A -1.4280
127 S A -1.7424
128 G A -1.7736
129 G A -1.2918
130 G A -1.1535
131 G A -1.1647
132 S A -0.9368
133 G A -1.5735
134 G A -1.1707
135 G A -1.3693
136 G A -1.1667
137 S A -1.0019
138 G A -1.4371
139 G A -1.6393
140 G A -1.4444
141 G A -1.6921
142 S A -1.2013
143 D A -1.7915
144 I A -1.1072
145 Q A -1.9047
146 L A 0.0000
147 T A -1.3210
148 Q A -1.0495
149 S A -0.8568
150 P A -0.6293
151 S A -0.8124
152 S A -1.0446
153 L A -0.6174
154 S A -0.8157
155 A A 0.0000
156 S A -0.2276
157 V A 0.6131
158 G A -0.6872
159 D A -1.5058
160 R A -2.2243
161 V A 0.0000
162 T A -0.5844
163 I A 0.0000
164 T A -0.8329
165 C A 0.0000
166 R A -2.7491
167 A A 0.0000
168 S A -1.7869
169 Q A -2.0002
170 S A -1.1922
171 I A 0.0000
172 S A -0.4982
173 S A -0.2717
174 Y A -0.1190
175 L A 0.0000
176 N A 0.0000
177 W A 0.0000
178 Y A 0.0000
179 Q A 0.0000
180 Q A 0.0000
181 K A -1.7698
182 P A -1.2093
183 G A -1.6435
184 K A -2.5809
185 A A -1.6161
186 P A 0.0000
187 K A -1.4522
188 L A 0.0000
189 L A 0.0000
190 I A 0.0000
191 Y A 0.2528
192 A A -0.0401
193 A A 0.0000
194 S A -0.1223
195 S A 0.1834
196 L A 0.3036
197 Q A -0.1662
198 S A -0.4855
199 G A -0.5840
200 V A 0.0000
201 P A -0.4054
202 S A -0.4588
203 R A -0.7890
204 F A 0.0000
205 S A -0.3477
206 G A -0.1990
207 S A -0.5724
208 G A -1.0585
209 S A -0.9514
210 G A -1.1006
211 T A -1.6841
212 D A -2.0193
213 F A 0.0000
214 T A -0.7489
215 L A 0.0000
216 T A -0.6092
217 I A 0.0000
218 S A -1.3316
219 S A -1.0791
220 L A 0.0000
221 Q A -0.8911
222 P A -0.8164
223 E A -1.8945
224 D A 0.0000
225 F A -0.5343
226 A A 0.0000
227 T A -0.9163
228 Y A 0.0000
229 Y A 0.0000
230 C A 0.0000
231 Q A 0.0000
232 Q A 0.0000
233 V A 0.0000
234 L A -0.7268
235 H A -1.2889
236 T A -0.7990
237 I A -0.3754
238 T A -0.3713
239 F A -0.1845
240 G A 0.0000
241 G A -1.1245
242 G A -0.8992
243 T A 0.0000
244 K A -1.7066
245 V A 0.0000
246 E A -1.1727
247 I A 0.6946
248 K A -0.9400
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6237 4.6783 View CSV PDB
4.5 -0.6569 4.6783 View CSV PDB
5.0 -0.6975 4.6783 View CSV PDB
5.5 -0.7363 4.6783 View CSV PDB
6.0 -0.7635 4.6783 View CSV PDB
6.5 -0.7727 4.6783 View CSV PDB
7.0 -0.7639 4.6783 View CSV PDB
7.5 -0.7424 4.6783 View CSV PDB
8.0 -0.7139 4.6783 View CSV PDB
8.5 -0.6807 4.6783 View CSV PDB
9.0 -0.6433 4.6783 View CSV PDB