| Chain sequence(s) |
A: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| pH calculations | No |
| alphaCutter usage |
A: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFN KFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY (Red indicates removed residues) |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:12)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:12)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:12)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:12)
[INFO] PDB: Running AlphaCutter (00:00:12)
[INFO] FoldX: Starting FoldX energy minimization (00:00:51)
[INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:03:04)
[INFO] AutoMut: Residue number 265 from chain A and a score of 0.779 (phenylalanine)
selected for automated mutation (00:03:05)
[INFO] AutoMut: Residue number 310 from chain A and a score of 0.315 (isoleucine) selected
for automated mutation (00:03:05)
[INFO] AutoMut: Residue number 308 from chain A and a score of -0.116 (isoleucine) selected
for automated mutation (00:03:05)
[INFO] AutoMut: Residue number 353 from chain A and a score of -0.182 (tryptophan) selected
for automated mutation (00:03:05)
[INFO] AutoMut: Mutating residue number 310 from chain A (isoleucine) into glutamic acid (00:03:05)
[INFO] AutoMut: Mutating residue number 265 from chain A (phenylalanine) into glutamic acid
Mutating residue number 265 from chain A (phenylalanine) into glutamic acid (00:03:05)
[INFO] AutoMut: Mutating residue number 265 from chain A (phenylalanine) into aspartic acid
Mutating residue number 265 from chain A (phenylalanine) into aspartic acid (00:03:05)
[INFO] AutoMut: Mutating residue number 265 from chain A (phenylalanine) into arginine (00:03:11)
[INFO] AutoMut: Mutating residue number 265 from chain A (phenylalanine) into lysine (00:03:12)
[INFO] AutoMut: Mutating residue number 310 from chain A (isoleucine) into lysine (00:03:18)
[INFO] AutoMut: Mutating residue number 310 from chain A (isoleucine) into aspartic acid (00:03:18)
[INFO] AutoMut: Mutating residue number 308 from chain A (isoleucine) into glutamic acid (00:03:20)
[INFO] AutoMut: Mutating residue number 310 from chain A (isoleucine) into arginine (00:03:27)
[INFO] AutoMut: Mutating residue number 308 from chain A (isoleucine) into lysine (00:03:32)
[INFO] AutoMut: Mutating residue number 308 from chain A (isoleucine) into aspartic acid (00:03:39)
[INFO] AutoMut: Mutating residue number 353 from chain A (tryptophan) into glutamic acid (00:03:46)
[INFO] AutoMut: Mutating residue number 353 from chain A (tryptophan) into aspartic acid (00:03:48)
[INFO] AutoMut: Mutating residue number 308 from chain A (isoleucine) into arginine (00:03:50)
[INFO] AutoMut: Mutating residue number 353 from chain A (tryptophan) into lysine (00:03:56)
[INFO] AutoMut: Mutating residue number 353 from chain A (tryptophan) into arginine (00:03:56)
[INFO] AutoMut: Effect of mutation residue number 265 from chain A (phenylalanine) into
glutamic acid: Energy difference: -0.4785 kcal/mol, Difference in average
score from the base case: -0.0751 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 265 from chain A (phenylalanine) into
lysine: Energy difference: 0.0768 kcal/mol, Difference in average score
from the base case: -0.0727 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 265 from chain A (phenylalanine) into
aspartic acid: Energy difference: -0.3381 kcal/mol, Difference in average
score from the base case: -0.0745 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 265 from chain A (phenylalanine) into
arginine: Energy difference: 0.0084 kcal/mol, Difference in average score
from the base case: -0.0723 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 310 from chain A (isoleucine) into
glutamic acid: Energy difference: 0.6384 kcal/mol, Difference in average
score from the base case: -0.1319 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 310 from chain A (isoleucine) into
lysine: Energy difference: -0.0786 kcal/mol, Difference in average score
from the base case: -0.0968 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 310 from chain A (isoleucine) into
aspartic acid: Energy difference: 0.6878 kcal/mol, Difference in average
score from the base case: -0.1324 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 310 from chain A (isoleucine) into
arginine: Energy difference: -0.0246 kcal/mol, Difference in average score
from the base case: -0.1096 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 308 from chain A (isoleucine) into
glutamic acid: Energy difference: 1.9621 kcal/mol, Difference in average
score from the base case: -0.0346 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 308 from chain A (isoleucine) into
lysine: Energy difference: 1.4343 kcal/mol, Difference in average score
from the base case: -0.0380 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 308 from chain A (isoleucine) into
aspartic acid: Energy difference: 2.8252 kcal/mol, Difference in average
score from the base case: -0.0340 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 308 from chain A (isoleucine) into
arginine: Energy difference: 0.6573 kcal/mol, Difference in average score
from the base case: -0.0505 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 353 from chain A (tryptophan) into
glutamic acid: Energy difference: 0.6577 kcal/mol, Difference in average
score from the base case: -0.0665 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 353 from chain A (tryptophan) into
lysine: Energy difference: 0.0039 kcal/mol, Difference in average score
from the base case: -0.0734 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 353 from chain A (tryptophan) into
aspartic acid: Energy difference: 0.9417 kcal/mol, Difference in average
score from the base case: -0.0616 (00:04:05)
[INFO] AutoMut: Effect of mutation residue number 353 from chain A (tryptophan) into
arginine: Energy difference: -0.3677 kcal/mol, Difference in average score
from the base case: -0.0704 (00:04:05)
[INFO] Main: Simulation completed successfully. (00:04:08)
|
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan4D score | mutation |
|---|---|---|---|---|
| 264 | K | A | -0.9260 | |
| 265 | F | A | 0.7787 | |
| 266 | G | A | -0.4541 | |
| 267 | G | A | -1.2161 | |
| 268 | P | A | -2.1152 | |
| 269 | R | A | -3.4461 | |
| 270 | D | A | -3.7801 | |
| 271 | Q | A | -3.6246 | |
| 272 | G | A | -2.7088 | |
| 273 | S | A | -2.6016 | |
| 274 | R | A | -3.6267 | |
| 275 | H | A | -3.3114 | |
| 276 | D | A | -3.7683 | |
| 277 | S | A | -3.4776 | |
| 278 | E | A | -3.6059 | |
| 279 | Q | A | -3.2678 | |
| 280 | D | A | -3.5005 | |
| 281 | N | A | -2.4911 | |
| 282 | S | A | -2.1809 | |
| 283 | D | A | -2.8174 | |
| 284 | N | A | -2.1470 | |
| 285 | N | A | -2.0901 | |
| 286 | T | A | 0.0000 | |
| 287 | I | A | 0.0000 | |
| 288 | F | A | -0.3682 | |
| 289 | V | A | 0.0000 | |
| 290 | Q | A | -1.7839 | |
| 291 | G | A | -2.1366 | |
| 292 | L | A | 0.0000 | |
| 293 | G | A | -2.2673 | |
| 294 | E | A | -3.2587 | |
| 295 | N | A | -2.5437 | |
| 296 | V | A | 0.0000 | |
| 297 | T | A | -1.0764 | |
| 298 | I | A | -1.0024 | |
| 299 | E | A | -2.2809 | |
| 300 | S | A | -1.5373 | |
| 301 | V | A | 0.0000 | |
| 302 | A | A | -1.9285 | |
| 303 | D | A | -2.9067 | |
| 304 | Y | A | -1.5952 | |
| 305 | F | A | 0.0000 | |
| 306 | K | A | -2.0963 | |
| 307 | Q | A | -1.7402 | |
| 308 | I | A | -0.1163 | |
| 309 | G | A | -0.5444 | |
| 310 | I | A | 0.3151 | |
| 311 | I | A | 0.0000 | |
| 312 | K | A | -1.6822 | |
| 313 | T | A | -1.5626 | |
| 314 | N | A | -2.1983 | |
| 315 | K | A | -3.0232 | |
| 316 | K | A | -2.9331 | |
| 317 | T | A | -2.0003 | |
| 318 | G | A | -2.1298 | |
| 319 | Q | A | -2.2522 | |
| 320 | P | A | -1.3016 | |
| 321 | M | A | -0.8674 | |
| 322 | I | A | 0.0000 | |
| 323 | N | A | -0.8239 | |
| 324 | L | A | -0.3813 | |
| 325 | Y | A | -0.9932 | |
| 326 | T | A | -2.3168 | |
| 327 | D | A | -3.0245 | |
| 328 | R | A | -3.5665 | |
| 329 | E | A | -3.3031 | |
| 330 | T | A | -2.5561 | |
| 331 | G | A | -2.7683 | |
| 332 | K | A | -3.5920 | |
| 333 | L | A | -2.6559 | |
| 334 | K | A | -3.0977 | |
| 335 | G | A | 0.0000 | |
| 336 | E | A | -1.4088 | |
| 337 | A | A | 0.0000 | |
| 338 | T | A | -0.2292 | |
| 339 | V | A | 0.0000 | |
| 340 | S | A | -0.7308 | |
| 341 | F | A | 0.0000 | |
| 342 | D | A | -2.3992 | |
| 343 | D | A | -2.9002 | |
| 344 | P | A | -2.4956 | |
| 345 | P | A | -1.7772 | |
| 346 | S | A | -1.4120 | |
| 347 | A | A | 0.0000 | |
| 348 | K | A | -1.7907 | |
| 349 | A | A | -0.6783 | |
| 350 | A | A | 0.0000 | |
| 351 | I | A | -1.1330 | |
| 352 | D | A | -1.7159 | |
| 353 | W | A | -0.1824 | |
| 354 | F | A | 0.0000 | |
| 355 | D | A | -2.7251 | |
| 356 | G | A | -2.5792 | |
| 357 | K | A | -2.8118 | |
| 358 | E | A | -3.2659 | |
| 359 | F | A | -1.7261 | |
| 360 | S | A | -1.4425 | |
| 361 | G | A | -1.6088 | |
| 362 | N | A | -2.1641 | |
| 363 | P | A | -2.5592 | |
| 364 | I | A | 0.0000 | |
| 365 | K | A | -3.0344 | |
| 366 | V | A | 0.0000 | |
| 367 | S | A | -0.9364 | |
| 368 | F | A | -0.4398 | |
| 369 | A | A | 0.0000 | |
| 370 | T | A | -1.0786 | |
| 371 | R | A | -1.8854 | |
| 372 | R | A | -2.7892 | |
| 373 | A | A | -2.1468 | |
| 374 | D | A | -2.6836 | |
| 375 | F | A | -1.0057 | |
| 376 | N | A | -2.4396 | |
| 377 | R | A | -3.0443 | |
| 378 | G | A | -1.9445 | |
| 379 | G | A | -1.4050 | |
| 380 | G | A | -1.0934 |
Automated mutations analysis - charged mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
| FE265A | -0.4785 | -0.0751 | View | CSV | PDB |
| FD265A | -0.3381 | -0.0745 | View | CSV | PDB |
| WR353A | -0.3677 | -0.0704 | View | CSV | PDB |
| IR310A | -0.0246 | -0.1096 | View | CSV | PDB |
| IK310A | -0.0786 | -0.0968 | View | CSV | PDB |
| WK353A | 0.0039 | -0.0734 | View | CSV | PDB |
| IR308A | 0.6573 | -0.0505 | View | CSV | PDB |
| IK308A | 1.4343 | -0.038 | View | CSV | PDB |