Project name: ok 11

Status: done

Started: 2026-03-17 06:57:57
Chain sequence(s) A: EIVLTQSPATLSLSPGERATLSCSASSSVSYMNWYKQKPGLAPRLLIYDTSKLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVQKPGASVKVSCKASGYTFNRYTMHWVRQAPGQLLWMGYINPSRGYYNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTTVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:02)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:15)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:16)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:16)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:05)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/22c3bd077eb5d2a/tmp/folded.pdb                (00:04:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:02)
Show buried residues

Minimal score value
-3.7118
Maximal score value
1.1338
Average score
-0.744
Total score value
-177.8169

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7203
2 I A 0.0000
3 V A 1.1117
4 L A 0.0000
5 T A -0.0959
6 Q A 0.0000
7 S A -0.4539
8 P A -0.3309
9 A A -0.3877
10 T A -0.5381
11 L A -0.4399
12 S A -0.9207
13 L A -1.1794
14 S A -1.7069
15 P A -1.8854
16 G A -2.4508
17 E A -2.9588
18 R A -3.2776
19 A A 0.0000
20 T A -0.5627
21 L A 0.0000
22 S A -0.6529
23 C A 0.0000
24 S A -0.7492
25 A A 0.0000
26 S A -0.2620
27 S A -0.5530
28 S A -0.7969
29 V A 0.0000
30 S A -0.4956
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.4036
37 Q A 0.0000
38 K A -0.7343
39 P A -0.4336
40 G A -0.4111
41 L A 0.0910
42 A A -0.2293
43 P A 0.0000
44 R A -0.6584
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.4836
49 D A -1.1154
50 T A -0.9184
51 S A -1.1197
52 K A -1.5083
53 L A -0.6657
54 A A 0.0000
55 T A -0.2934
56 G A -0.5877
57 I A -0.5891
58 P A -0.9711
59 D A -1.9068
60 R A -1.9280
61 F A 0.0000
62 S A -0.8989
63 G A -0.6834
64 S A -1.0533
65 G A -1.1983
66 S A -1.1055
67 G A -1.0352
68 T A -1.3065
69 D A -2.1726
70 F A 0.0000
71 T A -0.7470
72 L A 0.0000
73 T A -0.8181
74 I A 0.0000
75 S A -2.4245
76 R A -3.4059
77 L A 0.0000
78 E A -2.3785
79 P A -1.4110
80 E A -1.8524
81 D A 0.0000
82 F A -0.8150
83 A A 0.0000
84 V A -0.5249
85 Y A 0.0000
86 Y A 0.0000
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0731
91 S A -0.2947
92 S A -1.1090
93 N A -1.7275
94 P A -1.5793
95 F A 0.0000
96 T A -0.0565
97 F A 0.1983
98 G A 0.0000
99 Q A -1.0611
100 G A -0.9507
101 T A 0.0000
102 K A -1.1476
103 L A 0.0000
104 E A -1.4728
105 I A -1.0404
106 K A -1.9731
107 G A -1.5483
108 G A -1.3583
109 G A -1.2932
110 G A -1.1289
111 S A -1.0042
112 G A -1.2396
113 G A -1.5697
114 G A -1.4023
115 G A -1.3097
116 S A -1.2350
117 G A -1.2038
118 G A -1.2126
119 G A -1.3375
120 G A -1.4413
121 S A -1.3586
122 Q A -1.7523
123 V A -1.1361
124 Q A -1.6306
125 L A 0.0000
126 V A -0.3456
127 Q A 0.0000
128 S A -0.7611
129 G A -0.7593
130 A A -0.2163
131 E A -0.4504
132 V A 0.7707
133 Q A -0.8695
134 K A -2.0542
135 P A -2.0953
136 G A -1.4494
137 A A -1.1553
138 S A -1.3558
139 V A 0.0000
140 K A -2.1605
141 V A 0.0000
142 S A -0.7273
143 C A 0.0000
144 K A -1.0982
145 A A 0.0000
146 S A -0.8973
147 G A -0.9472
148 Y A -0.6871
149 T A -0.7697
150 F A 0.0000
151 N A -2.1201
152 R A -2.3506
153 Y A -1.2202
154 T A -0.5951
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A 0.0000
160 Q A -0.4452
161 A A -0.8307
162 P A -0.8129
163 G A -1.4403
164 Q A -1.6726
165 L A 0.0000
166 L A -0.2646
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.3595
171 I A 0.0000
172 N A -0.6123
173 P A 0.0000
174 S A -1.6881
175 R A -1.5744
176 G A -0.4745
177 Y A 1.0116
178 Y A 1.1338
179 N A -0.5786
180 Y A -1.4623
181 A A 0.0000
182 Q A -3.0651
183 K A -3.0373
184 F A 0.0000
185 K A -3.7118
186 D A -3.2863
187 R A -2.3233
188 V A 0.0000
189 T A -1.0545
190 M A 0.0000
191 T A -0.2533
192 R A -1.4686
193 D A -1.2054
194 T A -0.8833
195 S A -0.5766
196 T A -0.6913
197 S A -0.8894
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7670
201 M A 0.0000
202 E A -1.6309
203 L A 0.0000
204 S A -1.3148
205 S A -1.2365
206 L A 0.0000
207 R A -2.7529
208 S A -2.2296
209 E A -2.4373
210 D A 0.0000
211 T A -0.8705
212 A A 0.0000
213 V A 0.1764
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1076
221 D A -2.4516
222 D A -2.5009
223 H A -1.5242
224 Y A -0.4131
225 C A 0.0000
226 L A 0.0000
227 D A -0.1538
228 Y A -0.1873
229 W A -0.2326
230 G A 0.0000
231 Q A -1.0114
232 G A -0.3916
233 T A 0.0000
234 T A -0.0625
235 V A 0.0000
236 T A -0.3568
237 V A 0.0000
238 S A -0.8336
239 S A -0.9603
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7425 1.9796 View CSV PDB
4.5 -0.7859 1.9819 View CSV PDB
5.0 -0.8368 1.9883 View CSV PDB
5.5 -0.8868 2.0026 View CSV PDB
6.0 -0.9265 2.0266 View CSV PDB
6.5 -0.9491 2.0572 View CSV PDB
7.0 -0.9542 2.0908 View CSV PDB
7.5 -0.9467 2.1255 View CSV PDB
8.0 -0.9313 2.1605 View CSV PDB
8.5 -0.9089 2.1951 View CSV PDB
9.0 -0.8786 2.2286 View CSV PDB