Project name: 22f606dda2a8cec

Status: done

Started: 2026-06-26 08:41:42
Chain sequence(s) A: RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
B: MRVRKLPESFWKGP
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:40)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/22f606dda2a8cec/tmp/folded.pdb                (00:02:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:08)
Show buried residues

Minimal score value
-4.0972
Maximal score value
1.2863
Average score
-0.708
Total score value
-164.2445

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
217 R A -0.5872
218 S A 0.0000
219 V A 0.0000
220 A A -0.1508
221 S A -0.4976
222 S A -0.6480
223 K A -1.1990
224 L A 0.0000
225 W A 0.0550
226 M A 0.0000
227 L A -0.0191
228 E A -0.3113
229 F A -0.1859
230 S A 0.0000
231 A A 0.0309
232 F A 0.0000
233 L A 0.0000
234 E A -0.9448
235 Q A 0.0000
236 Q A -1.8253
237 Q A -2.1969
238 D A -2.2367
239 P A -1.7455
240 D A -2.2120
241 T A -1.3124
242 Y A -0.5844
243 N A -1.1019
244 K A -1.7180
245 H A -1.1565
246 L A -0.4927
247 F A 0.0000
248 V A 0.0000
249 H A -0.3511
250 I A 0.0000
251 G A -0.6395
252 Q A -0.8678
253 S A -0.8539
254 S A -0.6396
255 P A -0.4399
256 S A -0.0004
257 Y A 0.8116
258 S A 0.3996
259 D A 0.2099
260 P A 0.2546
261 Y A 0.9388
262 L A 0.1959
263 E A -0.1757
264 A A -0.4227
265 V A 0.0000
266 D A -1.7827
267 I A 0.0000
268 R A -3.0218
269 Q A -2.3036
270 I A 0.0000
271 Y A -1.9691
272 D A -2.3216
273 K A -1.1281
274 F A 0.0000
275 P A -2.5340
276 E A -4.0972
277 K A -3.7643
278 K A -3.3365
279 G A -2.0761
280 G A 0.0000
281 L A 0.0000
282 K A -3.5501
283 D A -3.2049
284 L A -1.9975
285 F A 0.0000
286 E A -3.4527
287 R A -3.1004
288 G A -2.0055
289 P A -1.2229
290 S A -1.1947
291 N A -0.7724
292 A A 0.0000
293 F A 0.0000
294 F A 0.0000
295 L A 0.0000
296 V A 0.0000
297 K A 0.0000
298 F A 0.0000
299 W A -0.3187
300 A A 0.0000
301 D A -0.5554
302 L A 0.0000
303 N A -0.8030
304 T A 0.0000
305 N A -1.3164
306 I A 0.5911
307 E A -1.0640
308 D A -2.2480
309 E A -1.6807
310 G A -1.5095
311 S A -1.2407
312 S A -0.6347
313 F A -0.0136
314 Y A 0.0000
315 G A 0.0000
316 V A -0.1376
317 S A -0.6959
318 S A 0.0000
319 Q A -0.6425
320 Y A 0.0000
321 E A -1.0127
322 S A 0.0000
323 P A -1.2957
324 E A -2.0016
325 N A -1.7090
326 M A 0.0000
327 I A -0.2410
328 I A 0.0000
329 T A -0.2691
330 C A 0.0000
331 S A 0.0000
332 T A 0.1563
333 K A -0.2811
334 V A 0.0000
335 C A 0.0000
336 S A 0.3758
337 F A 0.9033
338 G A 0.0000
339 K A -1.7888
340 Q A -1.0493
341 V A 0.6061
342 V A 0.0908
343 E A -0.0631
344 K A 0.2911
345 V A 1.2863
346 E A 0.3726
347 T A 0.1543
348 E A -0.1783
349 Y A 0.7093
350 A A -0.6004
351 R A -1.5450
352 Y A -0.4087
353 E A -1.3343
354 N A -1.8046
355 G A -1.2089
356 H A -1.6328
357 Y A -1.1587
358 S A 0.0000
359 Y A 0.0000
360 R A -1.2109
361 I A -0.9225
362 H A -1.4583
363 R A -1.2027
364 S A -0.7766
365 P A -0.5594
366 L A -0.2047
367 C A -0.7389
368 E A -1.6928
369 Y A -0.4601
370 M A 0.0000
371 I A -0.9749
372 N A -2.0020
373 F A 0.0000
374 I A 0.0000
375 H A -1.7783
376 K A -2.2312
377 L A 0.0000
378 K A -1.9447
379 H A -1.7300
380 L A -0.8305
381 P A -0.7790
382 E A -1.0865
383 K A -0.7368
384 Y A 0.5993
385 M A 0.2673
386 M A 0.0000
387 N A -0.2367
388 S A 0.0730
389 V A 0.2736
390 L A 0.0000
391 E A -0.2552
392 N A 0.1429
393 F A 0.0000
394 T A 0.0000
395 I A 0.0060
396 L A 0.0000
397 Q A 0.0000
398 V A 0.0000
399 V A 0.0000
400 T A 0.0000
401 N A -1.9642
402 R A -2.2780
403 D A -2.6392
404 T A -1.9653
405 Q A -2.4428
406 E A -2.0774
407 T A 0.0000
408 L A 0.0000
409 L A 0.0000
410 C A 0.0000
411 I A 0.0000
412 A A 0.0000
413 Y A 0.0000
414 V A 0.0000
415 F A 0.0000
416 E A -0.3160
417 V A 0.0000
418 S A 0.0000
419 A A -0.8387
420 S A -1.4504
421 E A -2.4207
422 H A -2.0793
423 G A -1.3509
424 A A 0.0000
425 Q A -1.0377
426 H A -0.6180
427 H A -0.5160
428 I A 0.0000
429 Y A 0.0000
430 R A -0.4828
431 L A 0.0000
432 V A -1.1626
433 K A -2.7504
434 E A -2.8352
1 M B 0.0894
2 R B 0.0000
3 V B -0.9671
4 R B -2.1292
5 K B -1.9485
6 L B 0.0000
7 P B -1.1293
8 E B -1.7333
9 S B -1.2929
10 F B -0.3613
11 W B 0.1877
12 K B -1.4343
13 G B -0.9165
14 P B -0.5698
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6607 2.9138 View CSV PDB
4.5 -0.7182 2.8582 View CSV PDB
5.0 -0.7878 2.7918 View CSV PDB
5.5 -0.8532 2.737 View CSV PDB
6.0 -0.8974 2.7186 View CSV PDB
6.5 -0.9107 2.7464 View CSV PDB
7.0 -0.8974 2.808 View CSV PDB
7.5 -0.8693 2.8867 View CSV PDB
8.0 -0.8345 2.9733 View CSV PDB
8.5 -0.7948 3.0661 View CSV PDB
9.0 -0.7498 3.2041 View CSV PDB