Project name: AlaVal_R4

Status: done

Started: 2026-08-20 09:25:36
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYVARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:12)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/244905197cff7a0/tmp/folded.pdb                (00:02:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:42)
Show buried residues

Minimal score value
-2.5442
Maximal score value
1.9805
Average score
-0.5305
Total score value
-131.5542

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4945
2 V A -1.0145
3 Q A -1.5293
4 L A 0.0000
5 Q A -1.6654
6 E A 0.0000
7 S A -0.6465
8 G A -0.3611
9 P A 0.0466
10 G A 0.3966
11 L A 0.9792
12 V A 0.0000
13 K A -1.8468
14 P A -1.3581
15 S A -1.4659
16 Q A -2.0433
17 T A -1.6172
18 L A 0.0000
19 S A -0.8737
20 L A 0.0000
21 T A -0.5779
22 A A 0.0000
23 T A -1.1270
24 V A 0.0000
25 S A -1.1838
26 G A -1.2527
27 G A -0.9759
28 S A -0.7249
29 I A 0.0000
30 S A -0.2636
31 S A -0.3336
32 G A -0.0726
33 D A -0.0073
34 Y A 0.6381
35 Y A 0.6396
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.6559
43 P A -0.6508
44 G A -1.1117
45 C A -1.2161
46 K A -2.0287
47 G A -1.2514
48 L A 0.0000
49 E A -0.7077
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1638
54 I A 0.0000
55 Y A 0.3319
56 Y A 0.3346
57 S A -0.1062
58 G A -0.2060
59 S A -0.2370
60 T A -0.1881
61 D A -0.6718
62 Y A -0.6707
63 N A -0.8937
64 P A -1.1769
65 S A -0.9831
66 L A 0.0000
67 K A -2.0880
68 S A -1.4299
69 R A -1.6630
70 V A 0.0000
71 T A -1.0312
72 M A 0.0000
73 S A -0.3492
74 V A -0.3526
75 D A -1.1742
76 T A -1.0280
77 S A -1.3345
78 K A -2.1626
79 N A -1.4255
80 Q A -1.2498
81 F A 0.0000
82 S A -0.4769
83 L A 0.0000
84 K A -1.3550
85 V A 0.0000
86 N A -1.7931
87 S A -1.5826
88 V A 0.0000
89 T A -0.6931
90 A A -0.2434
91 A A -0.0819
92 D A 0.0000
93 T A 0.3126
94 A A 0.0000
95 V A 0.2773
96 Y A 0.0000
97 Y A 0.0000
98 V A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.8018
103 I A 1.5360
104 F A 1.9805
105 G A 0.7099
106 V A 0.6327
107 G A 0.6259
108 T A 0.0000
109 F A 0.0000
110 D A -0.4456
111 Y A -0.2253
112 W A -0.6167
113 G A 0.0000
114 Q A -1.5611
115 G A -0.7251
116 T A -0.1327
117 L A 0.9178
118 V A 0.0000
119 T A 0.3701
120 V A 0.0000
121 S A -0.3787
122 S A -0.6417
123 A A -0.6452
124 A A -0.3508
125 G A -0.8345
126 G A -1.0629
127 G A -1.1228
128 G A -1.1677
129 S A -1.0215
130 G A -1.1959
131 G A -1.2085
132 G A -1.2045
133 G A -1.2278
134 S A -1.0244
135 G A -1.2040
136 G A -1.3884
137 G A -1.2367
138 G A -1.2789
139 S A -0.8922
140 D A -0.9068
141 I A -0.0999
142 V A 1.0138
143 M A 0.0000
144 T A -0.5812
145 Q A -0.6495
146 S A -0.7183
147 P A -0.3492
148 A A -0.3748
149 T A -0.5311
150 L A -0.2814
151 S A -0.4395
152 L A -0.6089
153 S A -0.8692
154 P A -1.3824
155 G A -1.6582
156 E A -2.1128
157 R A -2.5442
158 A A 0.0000
159 T A -0.6379
160 L A 0.0000
161 S A -0.8670
162 A A 0.0000
163 R A -2.3367
164 A A 0.0000
165 S A -0.8616
166 Q A -1.5694
167 S A -1.2048
168 V A 0.0000
169 S A -0.4133
170 S A -0.1819
171 Y A 0.8479
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4232
179 P A -0.8689
180 G A -0.9849
181 C A -1.1494
182 Q A -1.6168
183 A A -1.1552
184 P A 0.0000
185 R A -1.3972
186 L A -0.6768
187 L A 0.0000
188 I A 0.0000
189 Y A -0.4518
190 D A -0.5612
191 A A 0.0000
192 S A -1.1308
193 N A -1.7037
194 R A -1.6911
195 A A -1.0698
196 T A -0.6467
197 G A -0.6486
198 I A 0.0000
199 P A -0.4360
200 A A -0.3797
201 R A -0.7035
202 F A 0.0000
203 S A -0.7591
204 G A -0.8131
205 S A -0.8626
206 G A -1.1304
207 S A -0.9240
208 G A -1.0423
209 T A -1.7564
210 D A -2.1746
211 F A 0.0000
212 T A -0.7780
213 L A 0.0000
214 T A -0.5987
215 I A 0.0000
216 S A -1.2930
217 S A -1.6306
218 L A 0.0000
219 E A -2.1587
220 P A -1.4299
221 E A -2.2215
222 D A 0.0000
223 F A -0.6980
224 A A 0.0000
225 V A -0.6563
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3354
232 G A 0.0828
233 S A -0.1887
234 T A -0.3629
235 P A -0.3954
236 L A 0.0000
237 T A 0.2001
238 F A 0.2649
239 G A 0.0000
240 G A -0.8371
241 G A -0.8090
242 T A 0.0000
243 K A -0.9455
244 A A 0.0000
245 E A -0.5359
246 I A 0.6677
247 K A -0.9178
248 A A -0.3675
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4935 4.9259 View CSV PDB
4.5 -0.513 4.924 View CSV PDB
5.0 -0.5356 4.9185 View CSV PDB
5.5 -0.5559 4.9045 View CSV PDB
6.0 -0.568 4.877 View CSV PDB
6.5 -0.5673 4.8368 View CSV PDB
7.0 -0.5542 4.7895 View CSV PDB
7.5 -0.5329 4.7394 View CSV PDB
8.0 -0.5071 4.6883 View CSV PDB
8.5 -0.4784 4.637 View CSV PDB
9.0 -0.4472 4.5856 View CSV PDB