Project name: 253880f8732b4d4

Status: done

Started: 2026-06-03 09:12:57
Chain sequence(s) A: QVQLQQSGPELVRPGVSVRISCRGSTYTFTDYAIHWVKQSHARSLEWIGLISTYYGNANYNQKFKGKATMTVDKSSSTAYMELARLTSEDSAVYYCARNGDYSYAMDYWGQGTSVTVSS
B: DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKILIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEGDAAIYYCHQSNDDPPTFGAGTKLELK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:10)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/253880f8732b4d4/tmp/folded.pdb                (00:03:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:02)
Show buried residues

Minimal score value
-3.2452
Maximal score value
1.3338
Average score
-0.7009
Total score value
-161.2142

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.2821
2 V A -0.7510
3 Q A -1.7569
4 L A 0.0000
5 Q A -2.3276
6 Q A 0.0000
7 S A -1.3215
8 G A -1.0696
9 P A -0.4732
10 E A -0.3983
11 L A 0.7825
12 V A -0.2186
13 R A -1.7817
14 P A -1.6496
15 G A -1.2541
16 V A -0.8122
17 S A -1.4111
18 V A 0.0000
19 R A -2.3964
20 I A 0.0000
21 S A -1.1997
22 C A 0.0000
23 R A -2.4585
24 G A 0.0000
25 S A -1.0779
26 T A -0.4909
27 Y A -0.4323
28 T A -0.4975
29 F A 0.0000
30 T A -0.4929
31 D A -1.6135
32 Y A -0.7851
33 A A -0.1517
34 I A 0.0000
35 H A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A -0.2624
39 Q A 0.0000
40 S A -1.1925
41 H A -1.4585
42 A A -1.2455
43 R A -2.0110
44 S A -1.2960
45 L A 0.0000
46 E A -0.7471
47 W A 0.0000
48 I A 0.0000
49 G A 0.0000
50 L A -0.3528
51 I A 0.0000
52 S A 0.0228
53 T A 0.0000
54 Y A 1.0520
55 Y A 1.3338
56 G A 0.0017
57 N A -0.9997
58 A A -0.9716
59 N A -1.8846
60 Y A -1.6336
61 N A 0.0000
62 Q A -2.9735
63 K A -2.9018
64 F A 0.0000
65 K A -3.0008
66 G A -2.0454
67 K A -2.0056
68 A A 0.0000
69 T A -1.0423
70 M A 0.0000
71 T A -0.5236
72 V A -0.4365
73 D A -1.2995
74 K A -1.4914
75 S A -1.0726
76 S A -1.1284
77 S A -1.2757
78 T A 0.0000
79 A A 0.0000
80 Y A -0.7967
81 M A 0.0000
82 E A -1.8946
83 L A 0.0000
84 A A -1.5940
85 R A -2.1469
86 L A 0.0000
87 T A -1.5489
88 S A -1.4671
89 E A -1.9710
90 D A 0.0000
91 S A -0.6684
92 A A -0.3766
93 V A 0.0731
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 N A -0.1411
100 G A -0.2069
101 D A -1.1758
102 Y A 0.6518
103 S A 0.6165
104 Y A 0.9749
105 A A 0.0000
106 M A 0.0000
107 D A -0.1475
108 Y A -0.0807
109 W A -0.5439
110 G A 0.0000
111 Q A -1.6102
112 G A -0.9267
113 T A 0.0000
114 S A -0.1515
115 V A 0.0000
116 T A -0.1777
117 V A 0.0000
118 S A -0.6822
119 S A -0.7820
1 D B -2.1055
2 I B 0.0000
3 V B 0.8319
4 L B 0.0000
5 T B -0.3268
6 Q B -0.3957
7 S B -0.5488
8 P B -0.3416
9 A B -0.2704
10 S B -0.6008
11 L B -0.5069
12 A B -0.8218
13 V B 0.0000
14 S B -1.6288
15 L B -1.4451
16 G B -1.7839
17 Q B -2.4506
18 R B -3.0149
19 A B 0.0000
20 T B -0.7532
21 I B 0.0000
22 S B -0.8287
23 C B 0.0000
24 K B -1.8637
25 A B 0.0000
26 S B -0.9306
27 Q B -1.9479
28 S B -1.4569
29 V B 0.0000
30 D B -1.1991
31 F B -0.2186
32 D B -1.6058
33 G B -1.4147
34 D B -1.3842
35 S B -0.8977
36 Y B -0.0615
37 M B 0.0000
38 N B 0.0000
39 W B 0.0000
40 Y B 0.0000
41 Q B 0.0000
42 Q B 0.0000
43 K B -1.4932
44 P B -1.1248
45 G B -1.4308
46 Q B -2.0087
47 P B -1.2594
48 P B 0.0000
49 K B -1.2890
50 I B 0.0000
51 L B 0.0000
52 I B 0.0000
53 Y B 0.4100
54 A B 0.0000
55 A B 0.0000
56 S B -0.5441
57 N B -0.3749
58 L B -0.0181
59 E B -0.3615
60 S B -0.4991
61 G B -0.4730
62 I B -0.2282
63 P B -0.2068
64 A B -0.2575
65 R B -1.0079
66 F B 0.0000
67 S B -0.5452
68 G B -0.4612
69 S B -0.8514
70 G B -1.1264
71 S B -1.2266
72 G B -1.2146
73 T B -1.7679
74 D B -2.1813
75 F B 0.0000
76 T B -0.8340
77 L B 0.0000
78 N B -1.1088
79 I B 0.0000
80 H B -2.4253
81 P B -2.2662
82 V B 0.0000
83 E B -2.4463
84 E B -2.5085
85 G B -1.7199
86 D B 0.0000
87 A B -1.3643
88 A B 0.0000
89 I B -0.6936
90 Y B 0.0000
91 Y B 0.0000
92 C B 0.0000
93 H B 0.0000
94 Q B 0.0000
95 S B 0.0000
96 N B -1.4204
97 D B -2.9663
98 D B -3.2452
99 P B -2.6055
100 P B 0.0000
101 T B -0.5720
102 F B 0.3402
103 G B 0.0000
104 A B -0.2605
105 G B -0.5864
106 T B 0.0000
107 K B -1.1252
108 L B 0.0000
109 E B -1.8366
110 L B -1.4248
111 K B -1.6931
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6563 3.5155 View CSV PDB
4.5 -0.705 3.208 View CSV PDB
5.0 -0.7643 2.8398 View CSV PDB
5.5 -0.8234 2.4447 View CSV PDB
6.0 -0.8723 2.0401 View CSV PDB
6.5 -0.905 1.6336 View CSV PDB
7.0 -0.923 1.5911 View CSV PDB
7.5 -0.9319 1.6253 View CSV PDB
8.0 -0.9351 1.6619 View CSV PDB
8.5 -0.9327 1.6979 View CSV PDB
9.0 -0.9224 1.7393 View CSV PDB