Project name: c89a986ac2698fe [mutate: LQ4A, CQ5A, LQ9A, YQ46A, VQ115A, WQ121A, FQ132A, AQ133A, FQ173A]

Status: error

Started: 2026-01-01 07:35:06
Chain sequence(s) A: EKTLCDVCLKECSEFSAALNELKEDLETNAKELAGMKKNNNAVAFYAYLSKSLPLNSVSKHTTLKYDLVDLNLGNGYDKQTGLFTAPSNGLYVFNVATGAQDSSHSCLELAVNGVVKDLTWADSMDHVDRAFATTATPMSLNENDKVLARLGEAHGGNELESNKYLRTSFSGFKVQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues VQ115A,FQ173A,YQ46A,AQ133A,CQ5A,LQ4A,FQ132A,LQ9A,WQ121A
Energy difference between WT (input) and mutated protein (by FoldX) 0.0 kcal/mol
Error log 
One of Aggrescan4D modules (FoldX) encountered an error. 
FoldX didn't produce expected mutant file. Can't continue without it. This is unexpected and could indicate FoldX issues.