Project name: ok 9

Status: done

Started: 2026-03-17 06:57:09
Chain sequence(s) A: EIVLTKSPATLSLSPGERATLSCSASSSVSYMNWYQQKPGQAPRLLIYDTSNLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSSNPFTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLWMGYINPSRGYTNYAQKFKDRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARYYDDHYCLDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:01)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:06)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:07)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:03:23)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/272cfc8107e56f6/tmp/folded.pdb                (00:03:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:33)
Show buried residues

Minimal score value
-3.5694
Maximal score value
1.1162
Average score
-0.7474
Total score value
-178.6216

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7223
2 I A 0.0000
3 V A 1.0847
4 L A 0.0000
5 T A -0.1559
6 K A 0.0000
7 S A -0.4603
8 P A -0.2981
9 A A -0.3302
10 T A -0.4032
11 L A -0.4113
12 S A -0.8378
13 L A -1.1453
14 S A -1.9762
15 P A -2.3439
16 G A -2.5753
17 E A -2.9099
18 R A -3.0749
19 A A 0.0000
20 T A -0.5646
21 L A 0.0000
22 S A -0.6457
23 C A 0.0000
24 S A -0.7650
25 A A 0.0000
26 S A -0.2669
27 S A -0.5707
28 S A -0.8006
29 V A 0.0000
30 S A -0.4899
31 Y A 0.0000
32 M A 0.0000
33 N A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 Q A -0.4543
37 Q A 0.0000
38 K A -1.5558
39 P A -1.0723
40 G A -1.4443
41 Q A -2.1287
42 A A -1.2956
43 P A 0.0000
44 R A -0.7814
45 L A 0.0000
46 L A 0.0000
47 I A 0.0000
48 Y A -0.0969
49 D A -0.8281
50 T A -0.6475
51 S A -0.6164
52 N A -0.5025
53 L A -0.1303
54 A A 0.0000
55 T A -0.2149
56 G A -0.8112
57 I A -0.5205
58 P A -1.0143
59 D A -1.9026
60 R A -1.8697
61 F A 0.0000
62 S A -0.6903
63 G A -0.4602
64 S A -0.9275
65 G A -1.1771
66 S A -1.0979
67 G A -1.0408
68 T A -1.3122
69 D A -2.1680
70 F A 0.0000
71 T A -0.7355
72 L A 0.0000
73 T A -0.7752
74 I A 0.0000
75 S A -2.5061
76 R A -3.3922
77 L A 0.0000
78 E A -2.4350
79 P A -2.1848
80 E A -2.5030
81 D A 0.0000
82 F A -0.6603
83 A A 0.0000
84 V A -0.2214
85 Y A 0.0000
86 Y A -0.1785
87 C A 0.0000
88 Q A 0.0000
89 Q A 0.0000
90 W A -0.0869
91 S A -0.2956
92 S A -1.0902
93 N A -1.7228
94 P A -1.4810
95 F A 0.0000
96 T A 0.0000
97 F A 0.1548
98 G A 0.0000
99 Q A -1.3938
100 G A -0.9057
101 T A 0.0000
102 K A -0.7065
103 L A 0.0000
104 E A -1.2333
105 I A -1.7786
106 K A -2.3482
107 G A -1.7880
108 G A -1.7625
109 G A -1.4223
110 G A -1.6190
111 S A -1.1109
112 G A -1.6391
113 G A -1.6051
114 G A -1.7082
115 G A -1.5656
116 S A -1.1684
117 G A -1.2976
118 G A -1.3031
119 G A -1.3597
120 G A -1.5380
121 S A -1.3860
122 Q A -1.7968
123 V A 0.0000
124 Q A -1.4547
125 L A 0.0000
126 V A 0.5522
127 Q A 0.0000
128 S A -0.3964
129 G A -0.3941
130 A A 0.3187
131 E A 0.0225
132 V A 1.0180
133 K A -0.8551
134 K A -2.0491
135 P A -2.0284
136 G A -1.4370
137 A A -1.1485
138 S A -1.3495
139 V A 0.0000
140 K A -2.1476
141 V A 0.0000
142 S A -0.5556
143 C A 0.0000
144 K A -0.7612
145 A A 0.0000
146 S A -0.7591
147 G A -0.9156
148 Y A -0.5717
149 T A -0.5059
150 F A 0.0000
151 T A -1.2076
152 R A -1.9560
153 Y A -0.9838
154 T A -0.4578
155 M A 0.0000
156 H A 0.0000
157 W A 0.0000
158 V A 0.0000
159 R A -0.1826
160 Q A -0.4515
161 A A -0.8110
162 P A -0.9462
163 G A -1.4902
164 Q A -1.8647
165 G A -0.9562
166 L A -0.5857
167 W A 0.0000
168 M A 0.0000
169 G A 0.0000
170 Y A 0.1489
171 I A 0.0000
172 N A -0.7050
173 P A 0.0000
174 S A -1.3587
175 R A -1.7003
176 G A -0.7859
177 Y A 0.3853
178 T A 0.0855
179 N A -0.5402
180 Y A -1.3923
181 A A 0.0000
182 Q A -2.9504
183 K A -3.0298
184 F A 0.0000
185 K A -3.5694
186 D A -3.2608
187 R A -2.3013
188 V A 0.0000
189 T A -1.1646
190 M A 0.0000
191 T A -0.3869
192 R A -1.2698
193 D A -1.1342
194 T A -0.8847
195 S A -0.5556
196 T A -0.6666
197 S A -0.7270
198 T A 0.0000
199 V A 0.0000
200 Y A -0.7176
201 M A 0.0000
202 E A -1.6561
203 L A 0.0000
204 S A -1.3002
205 S A -1.2026
206 L A 0.0000
207 R A -2.5155
208 S A -2.1072
209 E A -2.3526
210 D A 0.0000
211 T A -0.6203
212 A A 0.0000
213 V A 0.5630
214 Y A 0.0000
215 Y A 0.0000
216 C A 0.0000
217 A A 0.0000
218 R A 0.0000
219 Y A 0.0000
220 Y A -1.1197
221 D A -2.4927
222 D A -2.5419
223 H A -1.4164
224 Y A -0.5043
225 C A 0.0000
226 L A 0.0000
227 D A 0.0000
228 Y A -0.1192
229 W A -0.2786
230 G A 0.0000
231 Q A -1.1638
232 G A -0.3584
233 T A 0.0000
234 L A 1.1162
235 V A 0.0000
236 T A -0.0086
237 V A 0.0000
238 S A -0.8225
239 S A -0.9527
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6851 1.7291 View CSV PDB
4.5 -0.7302 1.6983 View CSV PDB
5.0 -0.7824 1.6577 View CSV PDB
5.5 -0.8332 1.6141 View CSV PDB
6.0 -0.8737 1.5741 View CSV PDB
6.5 -0.8976 1.5446 View CSV PDB
7.0 -0.9044 1.5284 View CSV PDB
7.5 -0.8997 1.5366 View CSV PDB
8.0 -0.8879 1.6293 View CSV PDB
8.5 -0.8698 1.7205 View CSV PDB
9.0 -0.8445 1.8069 View CSV PDB