Project name: 27bc7de8c5dbe0

Status: done

Started: 2025-02-21 07:11:26
Chain sequence(s) A: MADNKQSFQAGQAAGRAEEKGNVLMDKVKDAATAAGASAQTAGQKITEAAGGAVNLVKEKTGMNK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-4.1581
Maximal score value
1.1142
Average score
-1.4899
Total score value
-96.8422

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.0130
2 A A -1.4534
3 D A -2.7750
4 N A -2.7769
5 K A -3.0043
6 Q A -3.0705
7 S A -1.9460
8 F A -0.7515
9 Q A -1.9210
10 A A -1.5107
11 G A -1.4430
12 Q A -2.2053
13 A A -1.8923
14 A A -2.1150
15 G A -3.1988
16 R A -4.1581
17 A A -3.2131
18 E A -3.9882
19 E A -3.9298
20 K A -3.1736
21 G A -2.2451
22 N A -2.0793
23 V A -0.1879
24 L A 0.4044
25 M A -0.1297
26 D A -2.0963
27 K A -1.7452
28 V A -0.0580
29 K A -2.1466
30 D A -2.8110
31 A A -1.3330
32 A A -1.1245
33 T A -1.1455
34 A A -0.7629
35 A A -0.7615
36 G A -0.8819
37 A A -0.6491
38 S A -0.8042
39 A A -1.1552
40 Q A -1.7614
41 T A -1.3667
42 A A -1.1689
43 G A -1.3657
44 Q A -2.3891
45 K A -2.2109
46 I A -0.0718
47 T A -0.9716
48 E A -2.1823
49 A A -0.9113
50 A A 0.0440
51 G A -0.5427
52 G A -0.1773
53 A A 0.8080
54 V A 1.0716
55 N A -0.4399
56 L A 0.7387
57 V A 1.1142
58 K A -1.1331
59 E A -2.4521
60 K A -1.9210
61 T A -1.1747
62 G A -1.7525
63 M A -1.1897
64 N A -2.8051
65 K A -2.4049
Download PDB file
View in 3Dmol