Project name: 2814d4409f52c6a

Status: done

Started: 2026-02-20 17:23:06
Chain sequence(s) B: EVQLLESGGGLVQPGGSLRLSCAASGFTIADASAMGWVRQAPGKGLEWVSTVSRSGLTYSALGGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAVSTLRPLTGLAADYWGQGTLVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYGGAGQRQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRSGLHTFGQGTKLEIK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:36)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2814d4409f52c6a/tmp/folded.pdb                (00:02:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:02)
Show buried residues

Minimal score value
-2.6153
Maximal score value
1.4521
Average score
-0.5484
Total score value
-125.0354

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E B -1.9877
2 V B -1.1473
3 Q B -1.1326
4 L B 0.0000
5 L B 0.9226
6 E B -0.0558
7 S B -0.4945
8 G B -0.9612
9 G B -0.1971
10 G B 0.4742
11 L B 1.4521
12 V B 0.0557
13 Q B -1.2177
14 P B -1.7460
15 G B -1.5498
16 G B -1.3056
17 S B -1.5776
18 L B -1.2383
19 R B -2.2242
20 L B 0.0000
21 S B -0.3720
22 C B 0.0000
23 A B -0.0306
24 A B -0.3993
25 S B -0.5279
26 G B -1.0735
27 F B -0.8332
28 T B -1.0261
29 I B 0.0000
30 A B -1.7414
31 D B -2.0496
32 A B 0.0000
33 S B -0.9054
34 A B -0.6818
35 M B 0.0000
36 G B 0.0000
37 W B 0.0000
38 V B 0.0000
39 R B 0.0000
40 Q B -0.6062
41 A B 0.0000
42 P B -0.7651
43 G B -1.2170
44 K B -1.9074
45 G B -1.4098
46 L B 0.0000
47 E B 0.0000
48 W B 0.0000
49 V B 0.0000
50 S B 0.0000
51 T B 0.1658
52 V B 0.0000
53 S B -0.6862
54 R B -2.1969
55 S B -0.8632
56 G B -0.4558
57 L B 0.9480
58 T B 0.4532
59 Y B 0.7435
60 S B 0.2326
61 A B 0.5323
62 L B 0.0000
63 G B -0.4243
64 G B -1.0026
65 R B -1.3682
66 F B 0.0000
67 T B -0.7835
68 I B 0.0000
69 S B -0.3393
70 R B -1.5200
71 D B -2.0002
72 N B -2.5750
73 S B -1.9683
74 K B -2.5821
75 N B -1.9188
76 T B 0.0000
77 L B 0.0000
78 Y B -0.3281
79 L B 0.0000
80 Q B -1.4423
81 M B 0.0000
82 N B -2.1462
83 S B -1.6176
84 L B 0.0000
85 R B -2.1690
86 A B -1.4425
87 E B -1.6857
88 D B 0.0000
89 T B -0.2655
90 A B 0.0000
91 V B 0.3430
92 Y B 0.0000
93 Y B 0.0000
94 C B 0.0000
95 A B -0.1399
96 V B 0.0000
97 S B -0.0464
98 T B 0.0261
99 L B 0.7032
100 R B 0.1453
101 P B 0.3652
102 L B 1.2413
103 T B 0.4262
104 G B 0.0722
105 L B 0.2559
106 A B 0.2745
107 A B 0.0293
108 D B -0.0976
109 Y B -0.2450
110 W B -0.4246
111 G B -0.6856
112 Q B -1.4647
113 G B -0.5369
114 T B 0.0429
115 L B 0.8942
116 V B 0.0000
117 T B 0.4121
118 V B -0.2173
119 S B -0.9798
120 S B -1.4084
136 D B -1.8519
137 I B -0.7412
138 Q B -1.0803
139 M B 0.0000
140 T B -0.9634
141 Q B 0.0000
142 S B -0.5566
143 P B -0.6273
144 S B -0.9772
145 S B -1.1610
146 L B -0.6607
147 S B -0.8642
148 A B 0.0000
149 S B -0.2698
150 V B 0.3824
151 G B -0.7130
152 D B -1.6535
153 R B -2.2343
154 V B 0.0000
155 T B -0.5291
156 I B 0.0000
157 T B -0.6984
158 C B 0.0000
159 R B -2.2472
160 A B -1.5867
161 S B -1.2081
162 Q B -1.5182
163 S B -1.1347
164 I B 0.0000
165 S B -0.5512
166 S B -0.1749
167 Y B 0.4141
168 L B 0.0000
169 N B -0.0190
170 W B 0.0000
171 Y B 0.0000
172 Q B 0.0000
173 Q B -1.4546
174 K B -2.0047
175 P B -1.2996
176 G B -1.7147
177 K B -2.6153
178 A B -1.6841
179 P B 0.0000
180 K B -1.4611
181 L B 0.0000
182 L B 0.0000
183 I B 0.0000
184 Y B -0.2237
185 G B -0.1687
186 G B 0.0000
187 A B -0.4547
188 G B -0.9085
189 Q B -1.4457
190 R B -1.2785
191 Q B 0.0000
192 S B -0.6831
193 G B -0.6724
194 V B 0.0000
195 P B -0.5654
196 S B -0.6362
197 R B -0.9045
198 F B 0.0000
199 S B -0.6838
200 G B -0.6094
201 S B -0.6967
202 G B -0.9739
203 S B -0.8126
204 G B -0.8823
205 T B -1.3803
206 D B -1.9577
207 F B 0.0000
208 T B -0.6530
209 L B 0.0000
210 T B -0.5816
211 I B 0.0000
212 S B -1.2310
213 S B -1.1299
214 L B 0.0000
215 Q B -1.1307
216 P B -0.7076
217 E B -1.9485
218 D B 0.0000
219 F B -0.7137
220 A B 0.0000
221 T B -1.0713
222 Y B 0.0000
223 Y B 0.0000
224 C B 0.0000
225 Q B 0.0000
226 Q B 0.0000
227 S B -0.3842
228 R B -1.2754
229 S B -0.4130
230 G B 0.1209
231 L B 1.1000
232 H B 0.2402
233 T B -0.1014
234 F B 0.0000
235 G B 0.0000
236 Q B -1.2551
237 G B 0.0000
238 T B 0.0000
239 K B -1.7751
240 L B 0.0000
241 E B -1.1507
242 I B 0.5973
243 K B -0.9762
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5709 2.5276 View CSV PDB
4.5 -0.6002 2.5276 View CSV PDB
5.0 -0.6333 2.5276 View CSV PDB
5.5 -0.6648 2.5276 View CSV PDB
6.0 -0.6887 2.5276 View CSV PDB
6.5 -0.6999 2.5276 View CSV PDB
7.0 -0.6979 2.5276 View CSV PDB
7.5 -0.6862 2.5276 View CSV PDB
8.0 -0.6682 2.5276 View CSV PDB
8.5 -0.6449 2.5276 View CSV PDB
9.0 -0.617 2.5276 View CSV PDB