Project name: hCT

Chain sequence(s)	A: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
pH calculations	Yes
alphaCutter usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[WARNING]    PDB-Info: The input structure is likely a peptide. Results may be inaccurate.         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:16)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/284a8c8170e488f/tmp/folded.pdb                (00:00:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)

• Minimal score value: -1.0957
• Maximal score value: 2.0046
• Average score: 0.4782
• Total score value: 15.3011

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan4D score	mutation
1	C	A	0.5225
2	G	A	-0.3074
3	N	A	-0.2724
4	L	A	1.3905
5	S	A	0.8602
6	T	A	0.9369
7	C	A	1.3465
8	M	A	1.7175
9	L	A	2.0046
10	G	A	0.9929
11	T	A	0.6361
12	Y	A	1.7543
13	T	A	0.4784
14	Q	A	-0.9610
15	D	A	-0.3852
16	F	A	1.0176
17	N	A	-0.8333
18	K	A	-1.0957
19	F	A	0.9647
20	H	A	-0.3798
21	T	A	0.0436
22	F	A	0.0424
23	P	A	-0.4591
24	Q	A	-0.1873
25	T	A	0.0202
26	A	A	0.6800
27	I	A	1.8175
28	G	A	0.9869
29	V	A	1.6248
30	G	A	0.4170
31	A	A	-0.0138
32	P	A	-0.0590

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is likely a peptide. Results may be inaccurate. The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH	Average A4D Score	Max A4D Score
4.0	1.7207	3.9451
4.5	1.6998	3.8621
5.0	1.68	3.7774
5.5	1.6703	3.7173
6.0	1.681	3.709
6.5	1.7135	3.7544
7.0	1.7548	3.8189
7.5	1.7935	3.8734
8.0	1.8287	3.9798
8.5	1.8646	4.1488
9.0	1.905	4.3263