Project name: 19fc3c2e8012f23 [mutate: VL11A]

Status: done

Started: 2026-03-13 21:38:30
Chain sequence(s) A: QVQLVESGGGVVQPGRSLRLSCGASGFTFRNYGMQWVRQGPGKGLEWVTLISFDGNDKYYADSVKGRFTISRDNSKNTLFLQMNSLRTEDTAVYYCARGGDFDYWGQGTLVTVSS
B: DIQMTQSPSSLSASVGDRVTITCRASQDIRKDLGWYQQKPGKAPKRLIYAASSLHSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPMYTFGQGTKLEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues VL11A
Energy difference between WT (input) and mutated protein (by FoldX) -2.57491 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:34)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:38)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2857afb3c4fb398/tmp/folded.pdb                (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:11)
Show buried residues

Minimal score value
-3.8098
Maximal score value
1.5776
Average score
-0.7207
Total score value
-160.7206

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4366
2 V A -0.7860
3 Q A -0.9337
4 L A 0.0000
5 V A 1.0931
6 E A 0.0000
7 S A -0.2000
8 G A -0.7225
9 G A 0.1291
10 G A 0.6571
11 L A 1.5418 mutated: VL11A
12 V A -0.1657
13 Q A -1.2731
14 P A -1.8378
15 G A -2.0903
16 R A -2.6504
17 S A -1.9943
18 L A -1.3148
19 R A -1.9400
20 L A 0.0000
21 S A -0.3361
22 C A 0.0000
23 G A -0.2301
24 A A 0.0000
25 S A -0.8029
26 G A -0.9785
27 F A -0.7076
28 T A -0.9715
29 F A 0.0000
30 R A -2.7156
31 N A -1.7326
32 Y A -0.3549
33 G A -0.2103
34 M A 0.0000
35 Q A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6941
40 G A -1.1532
41 P A -0.8925
42 G A -1.4978
43 K A -2.3804
44 G A -1.6285
45 L A 0.0000
46 E A -1.1707
47 W A 0.0000
48 V A 0.0000
49 T A 0.0000
50 L A 0.2534
51 I A 0.0000
52 S A -0.8396
53 F A -0.3834
54 D A -2.2272
55 G A -1.8812
56 N A -2.1911
57 D A -1.8576
58 K A -1.1365
59 Y A -0.2754
60 Y A -0.7891
61 A A -1.2499
62 D A -2.3545
63 S A -1.7197
64 V A 0.0000
65 K A -2.5018
66 G A -1.7261
67 R A -1.2725
68 F A 0.0000
69 T A -0.8376
70 I A 0.0000
71 S A -0.8396
72 R A -1.1037
73 D A -1.9340
74 N A -2.3500
75 S A -1.8455
76 K A -2.5725
77 N A -2.0747
78 T A -1.1623
79 L A 0.0000
80 F A -0.4300
81 L A 0.0000
82 Q A -1.1425
83 M A 0.0000
84 N A -1.8754
85 S A -1.7446
86 L A 0.0000
87 R A -2.4587
88 T A -1.7450
89 E A -2.2876
90 D A 0.0000
91 T A -0.4165
92 A A 0.0000
93 V A 0.7475
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 G A -0.1107
100 G A -0.3172
101 D A -0.6122
102 F A 0.0000
103 D A -0.4479
104 Y A -0.0803
105 W A -0.2257
106 G A 0.0000
107 Q A -1.1393
108 G A 0.0000
109 T A 0.6502
110 L A 1.5776
111 V A 0.0000
112 T A 0.4391
113 V A 0.0000
114 S A -0.5487
115 S A -0.4934
1 D B -2.0664
2 I B 0.0000
3 Q B -2.1869
4 M B 0.0000
5 T B -1.2173
6 Q B 0.0000
7 S B -0.6343
8 P B -0.5496
9 S B -0.8333
10 S B -1.0553
11 L B -0.6259
12 S B -0.8649
13 A B 0.0000
14 S B -0.1000
15 V B 0.6801
16 G B -0.5150
17 D B -1.3467
18 R B -2.1298
19 V B 0.0000
20 T B -0.5621
21 I B 0.0000
22 T B -0.7725
23 C B 0.0000
24 R B -2.4900
25 A B 0.0000
26 S B -2.2359
27 Q B -3.0360
28 D B -3.6118
29 I B 0.0000
30 R B -3.8098
31 K B -3.4083
32 D B -2.1781
33 L B 0.0000
34 G B 0.0000
35 W B 0.0000
36 Y B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.7583
40 P B -1.1849
41 G B -1.6321
42 K B -2.6336
43 A B -1.7279
44 P B 0.0000
45 K B -1.8526
46 R B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.0197
50 A B -0.9531
51 A B 0.0000
52 S B -0.4882
53 S B 0.0067
54 L B 0.3986
55 H B -0.1929
56 S B -0.3453
57 G B -0.4804
58 V B -0.3597
59 P B -0.3155
60 S B -0.3969
61 R B -0.7972
62 F B 0.0000
63 S B -0.2957
64 G B -0.2270
65 S B -0.9937
66 G B -1.7266
67 S B -2.5214
68 G B -3.0184
69 T B -2.9260
70 E B -3.1971
71 F B 0.0000
72 T B -0.8108
73 L B 0.0000
74 T B -0.6000
75 I B 0.0000
76 S B -1.2643
77 S B -1.0258
78 L B 0.0000
79 Q B -0.8886
80 P B -0.6640
81 E B -1.9088
82 D B 0.0000
83 F B -0.6447
84 A B 0.0000
85 T B -1.0624
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 L B 0.0000
90 Q B 0.0000
91 H B -0.4936
92 N B -0.9732
93 S B 0.0861
94 Y B 1.0178
95 P B 0.8275
96 M B 0.2408
97 Y B 0.0000
98 T B -0.7515
99 F B 0.0000
100 G B 0.0000
101 Q B -1.6058
102 G B 0.0000
103 T B 0.0000
104 K B -1.7170
105 L B 0.0000
106 E B -1.1608
107 I B 0.6218
108 K B -0.8792
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.8202 2.2459 View CSV PDB
4.5 -0.8638 2.2459 View CSV PDB
5.0 -0.9128 2.2459 View CSV PDB
5.5 -0.9589 2.2459 View CSV PDB
6.0 -0.9926 2.2459 View CSV PDB
6.5 -1.0069 2.2459 View CSV PDB
7.0 -1.0027 2.2459 View CSV PDB
7.5 -0.9862 2.2459 View CSV PDB
8.0 -0.9618 2.2459 View CSV PDB
8.5 -0.9301 2.2459 View CSV PDB
9.0 -0.8908 2.2459 View CSV PDB