Project name: 2a331313a15ee97

Status: done

Started: 2026-05-18 01:42:38
Chain sequence(s) A: MKSFLILLGFAALAAADVKHLTDRNLDLFKYNPSDIYTLPEDIDDDKPAVHFSGDVMKAKTETLQNYNSGKKFKLELKTQNGIEVSSVGKLKDDKTFVVSGSYSFTGADGKRYKTRYTADEFGYHPITELDLDIPEPQPLASAGQRQTVDPSSLLGNKNRFQFLQQTLDSDQGSQGPLRGSGQSGDDYSYTSPYGNGNAYGNGVGNGYGNGVGNGYGNGVGNGQGNGAGNAYGNGNGVGNGYGNGNGNGYDYQPPQVPLATPSRLYLPTA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:02:56)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2a331313a15ee97/tmp/folded.pdb                (00:02:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:25)
Show buried residues

Minimal score value
-4.3348
Maximal score value
4.3933
Average score
-0.7015
Total score value
-189.3924

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1853
2 K A -0.9057
3 S A 0.7103
4 F A 3.0882
5 L A 4.1114
6 I A 4.3933
7 L A 4.0237
8 L A 3.2177
9 G A 1.7991
10 F A 2.5217
11 A A 1.4470
12 A A 1.3080
13 L A 1.9206
14 A A 0.5875
15 A A 0.2637
16 A A -0.2732
17 D A -1.6462
18 V A 0.0689
19 K A -1.4941
20 H A -0.9290
21 L A 0.5644
22 T A -0.5053
23 D A -0.8773
24 R A -1.8524
25 N A 0.0000
26 L A -0.7650
27 D A -1.8923
28 L A -0.9147
29 F A 0.0000
30 K A -1.6288
31 Y A -0.9252
32 N A -0.9675
33 P A -0.5347
34 S A -0.4358
35 D A -0.3454
36 I A 0.9272
37 Y A 0.0000
38 T A 0.0000
39 L A -0.4285
40 P A -1.5596
41 E A -2.8465
42 D A -3.0979
43 I A -2.8311
44 D A -3.9522
45 D A -4.3348
46 D A -3.7818
47 K A -3.2812
48 P A -2.0932
49 A A -0.8663
50 V A -0.0872
51 H A -0.9096
52 F A -0.1069
53 S A -0.4432
54 G A -0.8774
55 D A -0.8788
56 V A 0.7033
57 M A 0.3657
58 K A -1.6461
59 A A -1.3704
60 K A -2.5876
61 T A -1.9263
62 E A -2.3454
63 T A -0.9354
64 L A 0.4671
65 Q A -0.2763
66 N A -1.0314
67 Y A -0.6497
68 N A -1.7147
69 S A -1.4260
70 G A -1.6919
71 K A -2.5916
72 K A -1.5240
73 F A -0.7135
74 K A 0.0000
75 L A -0.0250
76 E A -0.1930
77 L A -0.1233
78 K A -1.2972
79 T A -1.4044
80 Q A -1.7018
81 N A -0.5378
82 G A 0.0000
83 I A 0.5832
84 E A -0.2245
85 V A 0.4083
86 S A -0.1392
87 S A 0.0000
88 V A 0.0000
89 G A 0.0000
90 K A -0.6956
91 L A -1.4923
92 K A -2.0757
93 D A -3.0827
94 D A -3.3911
95 K A -2.9325
96 T A 0.0000
97 F A -0.4868
98 V A 0.0000
99 V A 0.5792
100 S A 0.0000
101 G A 0.0000
102 S A -0.0510
103 Y A 0.4787
104 S A 0.0000
105 F A 0.9779
106 T A -0.3711
107 G A -0.8955
108 A A -1.1458
109 D A -2.4222
110 G A -1.8026
111 K A -2.4268
112 R A -1.8017
113 Y A -0.4768
114 K A -0.6375
115 T A -0.1912
116 R A -0.6011
117 Y A 0.0868
118 T A 0.0000
119 A A 0.6594
120 D A 0.0559
121 E A -0.2398
122 F A 1.3992
123 G A 0.7469
124 Y A 1.1824
125 H A 0.6086
126 P A -0.1326
127 I A 0.1900
128 T A -0.6084
129 E A -1.5189
130 L A -0.8683
131 D A -1.5498
132 L A 0.4884
133 D A -0.8097
134 I A 0.7207
135 P A -0.7486
136 E A -2.1662
137 P A -1.2875
138 Q A -1.5662
139 P A -0.4413
140 L A 1.0372
141 A A 0.3538
142 S A -0.0908
143 A A -0.7280
144 G A -1.7121
145 Q A -2.7565
146 R A -2.8359
147 Q A -2.3094
148 T A -1.1353
149 V A 0.2479
150 D A -1.0851
151 P A -0.0112
152 S A -0.0046
153 S A 0.2977
154 L A 1.0742
155 L A 1.2156
156 G A -0.7794
157 N A -2.2493
158 K A -2.8625
159 N A -2.9718
160 R A -2.1052
161 F A 0.1121
162 Q A -0.8022
163 F A 1.4662
164 L A 1.5065
165 Q A -0.5776
166 Q A -0.8688
167 T A -0.8386
168 L A 0.0576
169 D A -2.0855
170 S A -2.0668
171 D A -2.9487
172 Q A -2.8742
173 G A -2.0633
174 S A -1.6961
175 Q A -1.5433
176 G A -1.1477
177 P A -0.7397
178 L A -0.0314
179 R A -1.5870
180 G A -1.3674
181 S A -1.4189
182 G A -1.6743
183 Q A -2.1339
184 S A -1.8780
185 G A -2.1958
186 D A -2.8214
187 D A -2.0736
188 Y A 0.1427
189 S A 0.2726
190 Y A 1.2106
191 T A 0.6900
192 S A 0.1191
193 P A 0.1840
194 Y A 0.5181
195 G A -0.9341
196 N A -1.7575
197 G A -1.3594
198 N A -1.6431
199 A A -0.7614
200 Y A 0.2864
201 G A -0.7614
202 N A -1.2759
203 G A -0.6902
204 V A 0.5993
205 G A -0.7721
206 N A -1.7025
207 G A -1.3940
208 Y A -0.6517
209 G A -1.6283
210 N A -2.2011
211 G A -1.5805
212 V A -0.2674
213 G A -1.1135
214 N A -1.4502
215 G A -0.7095
216 Y A 0.2595
217 G A -0.9494
218 N A -1.8996
219 G A -1.1364
220 V A 0.4603
221 G A -1.0201
222 N A -1.9864
223 G A -2.3431
224 Q A -2.7347
225 G A -2.4617
226 N A -2.4855
227 G A -2.2765
228 A A -1.7216
229 G A -1.6809
230 N A -1.6896
231 A A -0.5237
232 Y A 0.3549
233 G A -1.0710
234 N A -2.0655
235 G A -1.7958
236 N A -1.6381
237 G A -0.7496
238 V A 0.5566
239 G A -1.0149
240 N A -1.7031
241 G A -1.4602
242 Y A -0.2612
243 G A -1.6630
244 N A -2.1370
245 G A -2.3305
246 N A -2.5039
247 G A -2.2512
248 N A -2.1393
249 G A -1.2175
250 Y A 0.0803
251 D A -1.1580
252 Y A 0.1025
253 Q A -1.2386
254 P A -0.7938
255 P A -0.5541
256 Q A -0.5407
257 V A 1.3915
258 P A 1.0000
259 L A 1.7039
260 A A 0.8734
261 T A -0.0680
262 P A -0.4671
263 S A -0.5881
264 R A -0.6871
265 L A 1.5735
266 Y A 2.1743
267 L A 2.2289
268 P A 1.0416
269 T A 0.4071
270 A A 0.1622
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 0.2303 6.2407 View CSV PDB
4.5 0.1492 6.2407 View CSV PDB
5.0 0.0555 6.2407 View CSV PDB
5.5 -0.0374 6.2407 View CSV PDB
6.0 -0.1157 6.2407 View CSV PDB
6.5 -0.1711 6.2407 View CSV PDB
7.0 -0.2059 6.2407 View CSV PDB
7.5 -0.2267 6.2407 View CSV PDB
8.0 -0.2362 6.2407 View CSV PDB
8.5 -0.2326 6.2407 View CSV PDB
9.0 -0.2121 6.2407 View CSV PDB