Project name: PT_mut_5_protenix

Status: done

Started: 2026-05-11 03:30:48
Chain sequence(s) A: EVKLVESGGDLVKPGGSLKLSCAASGFTFSAYAHSWVRQNPEKRLEWVASISKGGNTYYPNSVKGRFTISRDNARNILYLQMSSLRSEDTALYYCARGWGNYGWFAYWGQVTLVTVSA
B: DIKMTQSPSSMYASLGERVTITCKASQDINRYLNWFQQKPGKSPKTLIYRANRLLSGVPSRFSGSGSGQDYSLTISSLDYEDMGIYYCLQYDEYPLTFGDGTKLELK
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:02:59)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:33:49)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:33:50)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:33:51)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:33:52)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:33:53)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:33:53)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:33:54)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:33:55)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:33:56)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:33:57)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:33:57)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:33:58)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:33:59)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:34:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:34:03)
Show buried residues

Minimal score value
-2.4847
Maximal score value
1.6755
Average score
-0.5574
Total score value
-125.4154

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.8356
2 V A -1.1706
3 K A -1.5068
4 L A -0.2205
5 V A 0.9801
6 E A 0.2925
7 S A -0.2518
8 G A -0.3918
9 G A -0.2413
10 D A -0.2855
11 L A 0.6721
12 V A 0.0000
13 K A -1.6139
14 P A -1.2033
15 G A -1.1593
16 G A -1.0863
17 S A -1.1942
18 L A 0.0000
19 K A -1.8405
20 L A 0.0000
21 S A -0.2429
22 C A 0.0000
23 A A -0.0713
24 A A 0.0000
25 S A -0.9773
26 G A -1.3232
27 F A 0.0000
28 T A -0.6669
29 F A 0.0000
30 S A -0.6626
31 A A -0.3113
32 Y A -0.0297
33 A A -0.1690
34 H A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 N A 0.0000
41 P A -1.5322
42 E A -2.0639
43 K A -2.3023
44 R A -1.6079
45 L A 0.0000
46 E A 0.0000
47 W A 0.0000
48 V A 0.0000
49 A A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A -0.9492
53 K A -2.1732
54 G A -1.6994
55 G A -1.9047
56 N A -1.5315
57 T A -0.2148
58 Y A 1.6501
59 Y A 1.6755
60 P A 0.0000
61 N A 0.2500
62 S A 0.1023
63 V A 0.2188
64 K A -0.6732
65 G A -1.4577
66 R A -1.9912
67 F A 0.0000
68 T A -0.8246
69 I A 0.0000
70 S A -1.4335
71 R A -1.9922
72 D A -2.4780
73 N A -2.4171
74 A A -1.7167
75 R A -2.4847
76 N A -1.6837
77 I A -0.6128
78 L A 0.0000
79 Y A -0.3994
80 L A 0.0000
81 Q A -1.3142
82 M A 0.0000
83 S A -1.4009
84 S A -1.2214
85 L A 0.0000
86 R A -0.6043
87 S A -1.0294
88 E A -1.9435
89 D A 0.0000
90 T A -0.0409
91 A A 0.0000
92 L A 0.2884
93 Y A 0.0000
94 Y A 0.0000
95 C A 0.0000
96 A A 0.0000
97 R A 0.0000
98 G A 0.0000
99 W A 0.1341
100 G A -0.2157
101 N A -0.6301
102 Y A 0.4479
103 G A 0.0000
104 W A 0.2207
105 F A 0.0000
106 A A 0.0000
107 Y A -0.0092
108 W A 0.0000
109 G A -0.5402
110 Q A -0.5423
111 V A 0.2984
112 T A 0.0000
113 L A 1.1997
114 V A 0.0000
115 T A 0.3398
116 V A 0.0199
117 S A -0.3049
118 A A -0.5404
1 D B -1.4870
2 I B -0.4470
3 K B -1.2351
4 M B 0.0000
5 T B -0.9829
6 Q B -1.0692
7 S B -0.8668
8 P B -0.4345
9 S B -0.5544
10 S B -0.6899
11 M B -0.5119
12 Y B -0.1717
13 A B 0.0000
14 S B -0.8170
15 L B -0.3868
16 G B -1.1142
17 E B -2.2719
18 R B -2.2531
19 V B 0.0000
20 T B -0.4772
21 I B 0.0000
22 T B -0.8491
23 C B 0.0000
24 K B -2.4295
25 A B -1.7046
26 S B 0.0000
27 Q B -1.8314
28 D B -1.1992
29 I B 0.5747
30 N B -1.0661
31 R B -1.3103
32 Y B -0.7232
33 L B 0.0000
34 N B 0.0000
35 W B 0.0000
36 F B 0.0000
37 Q B 0.0000
38 Q B 0.0000
39 K B -1.2753
40 P B -1.3330
41 G B -1.4730
42 K B -1.9828
43 S B -1.2391
44 P B 0.0000
45 K B -0.4008
46 T B 0.0000
47 L B 0.0000
48 I B 0.0000
49 Y B 0.0000
50 R B -1.1662
51 A B -1.1396
52 N B -1.8110
53 R B -2.1316
54 L B -0.1266
55 L B 0.2544
56 S B 0.4677
57 G B 0.3786
58 V B 0.9914
59 P B 0.0000
60 S B -0.2241
61 R B 0.0000
62 F B 0.0000
63 S B -0.3783
64 G B -0.5654
65 S B -0.5213
66 G B -1.0411
67 S B -1.0537
68 G B -1.1390
69 Q B -1.9854
70 D B -2.0791
71 Y B -1.2055
72 S B -0.7265
73 L B 0.0000
74 T B -0.4486
75 I B -0.4790
76 S B -0.8724
77 S B -0.6624
78 L B 0.0000
79 D B -1.5284
80 Y B -0.6501
81 E B -1.3369
82 D B 0.0000
83 M B 0.0000
84 G B -0.9916
85 I B -1.2555
86 Y B 0.0000
87 Y B 0.0000
88 C B 0.0000
89 L B 0.0000
90 Q B 0.0000
91 Y B 0.0000
92 D B -1.7490
93 E B -1.7926
94 Y B 0.1444
95 P B -0.0472
96 L B 0.0000
97 T B 0.0000
98 F B 0.0000
99 G B 0.0000
100 D B -1.1612
101 G B -1.5136
102 T B 0.0000
103 K B -2.0377
104 L B 0.0000
105 E B -1.8590
106 L B -0.5616
107 K B -1.2508
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.5574 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_6 -0.5574 View CSV PDB
model_9 -0.5833 View CSV PDB
model_5 -0.5864 View CSV PDB
model_1 -0.6109 View CSV PDB
model_11 -0.6158 View CSV PDB
model_2 -0.6313 View CSV PDB
CABS_average -0.6517 View CSV PDB
model_7 -0.6633 View CSV PDB
model_10 -0.6733 View CSV PDB
model_3 -0.6882 View CSV PDB
model_0 -0.6951 View CSV PDB
input -0.7311 View CSV PDB
model_8 -0.7461 View CSV PDB
model_4 -0.7691 View CSV PDB