Project name: HSA7C1_prot3D_74_015M

Status: done

Started: 2026-02-25 09:24:10
Chain sequence(s) A: QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYFCQSYDSSLGGWVFGGGTKVTVL
B: QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARAHGNAVSDVWGQGTTVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:53)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2a9f3b760def212/tmp/folded.pdb                (00:01:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:22)
Show buried residues

Minimal score value
-2.8587
Maximal score value
1.5138
Average score
-0.5373
Total score value
-123.0429

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -0.5061
2 S A 0.4810
3 V A 1.4536
4 L A 0.0000
5 T A 0.0937
6 Q A 0.0000
7 P A -0.3956
8 P A -0.5766
9 S A -0.4402
11 V A -0.0266
12 S A -0.1071
13 G A 0.0000
14 A A -0.2469
15 P A -0.9966
16 G A -1.8826
17 Q A -2.4184
18 R A -2.6903
19 V A 0.0000
20 T A -0.5173
21 I A 0.0000
22 S A -0.3254
23 C A 0.0000
24 T A -0.2381
25 G A -0.0263
26 S A -0.1430
27 S A -0.6443
28 S A -0.2671
29 N A 0.0000
30 I A 0.0000
31 G A -0.8702
35 A A -0.5360
36 G A -0.6784
37 Y A -0.4141
38 D A -1.2230
39 V A 0.0000
40 H A -0.6415
41 W A 0.0000
42 Y A 0.0000
43 Q A -0.4058
44 Q A 0.0000
45 L A -0.0243
46 P A -0.3273
47 G A -0.3534
48 T A -0.3653
49 A A -0.4671
50 P A 0.0000
51 K A -0.9568
52 L A 0.0000
53 L A 0.0000
54 I A 0.0000
55 Y A -0.7951
56 G A -0.9519
57 N A -1.2280
65 S A -1.3129
66 N A -1.6356
67 R A -1.9169
68 P A -0.9976
69 S A -0.7778
70 G A -0.9776
71 V A -0.7921
72 P A -1.2830
74 D A -2.1960
75 R A -1.5716
76 F A 0.0000
77 S A -0.9954
78 G A -0.8088
79 S A -0.8684
80 K A -1.1005
83 S A -0.7887
84 G A -0.9009
85 T A -0.6935
86 S A -0.6408
87 A A 0.0000
88 S A -0.4562
89 L A 0.0000
90 A A -0.5764
91 I A 0.0000
92 T A -1.9498
93 G A -1.9335
94 L A 0.0000
95 Q A -1.7598
96 A A -1.3002
97 E A -2.1680
98 D A 0.0000
99 E A -1.3189
100 A A 0.0000
101 D A -0.5936
102 Y A 0.0000
103 F A 0.0000
104 C A 0.0000
105 Q A 0.0000
106 S A 0.0000
107 Y A 0.1844
108 D A 0.0000
109 S A -0.0762
110 S A -0.0000
113 L A 0.4647
114 G A 0.4171
115 G A 0.0000
116 W A 0.5395
117 V A 0.0000
118 F A 0.0000
119 G A 0.0000
120 G A -0.4161
121 G A 0.0000
122 T A 0.0000
123 K A -0.6600
124 V A 0.0000
125 T A 0.1263
126 V A 0.2699
127 L A 1.3404
1 Q B -0.8202
2 V B 0.3472
3 Q B -0.1543
4 L B 0.0000
5 V B 0.6319
6 Q B -0.0159
7 S B -0.6927
8 G B -0.8985
9 G B -0.5858
11 G B 0.4244
12 V B 1.5138
13 V B 0.1263
14 Q B -1.5903
15 P B -2.2343
16 G B -2.2306
17 R B -2.8587
18 S B -2.1906
19 L B -1.2781
20 R B -2.0906
21 L B 0.0000
22 S B -0.5209
23 C B 0.0000
24 A B -0.1984
25 A B -0.1128
26 S B -0.2662
27 G B -0.2626
28 F B -0.0024
29 T B -0.4481
30 F B -0.4157
35 S B -0.0862
36 S B -0.2954
37 Y B -0.3652
38 G B -0.1429
39 M B 0.0000
40 H B 0.0000
41 W B 0.0000
42 V B 0.0000
43 R B 0.0000
44 Q B -0.6720
45 A B -0.9404
46 P B -0.9585
47 G B -1.4725
48 K B -2.1884
49 G B -1.3719
50 L B 0.0000
51 E B -0.6097
52 W B 0.0000
53 V B 0.0000
54 A B 0.0000
55 V B 0.0000
56 I B 0.0000
57 W B 0.0103
58 Y B 0.3351
59 D B -1.3317
62 G B -0.9239
63 S B -0.7989
64 N B -0.6064
65 K B -0.6210
66 Y B 0.0949
67 Y B -0.5614
68 A B 0.0000
69 D B -2.4367
70 S B -1.8804
71 V B 0.0000
72 K B -2.5013
74 G B -1.7516
75 R B -1.7287
76 F B 0.0000
77 T B -0.7934
78 I B 0.0000
79 S B -0.7412
80 R B -1.1933
81 D B -1.5677
82 N B -1.5147
83 S B -1.5493
84 K B -2.2414
85 N B -1.5173
86 T B 0.0000
87 L B 0.0000
88 Y B -0.4708
89 L B 0.0000
90 Q B -1.2176
91 M B 0.0000
92 N B -2.3164
93 S B -2.0990
94 L B 0.0000
95 R B -2.6719
96 A B -1.4979
97 E B -1.5669
98 D B 0.0000
99 T B -0.2362
100 A B 0.0000
101 V B 0.1550
102 Y B 0.0000
103 Y B 0.0000
104 C B 0.0000
105 A B 0.0000
106 R B 0.0000
107 A B 0.0000
108 H B -1.3220
109 G B -1.2296
110 N B -1.6048
113 A B -0.8050
114 V B -0.3090
115 S B -0.6101
116 D B -0.2776
117 V B 0.0450
118 W B 0.0000
119 G B 0.0000
120 Q B -0.9599
121 G B -0.4707
122 T B 0.0000
123 T B 0.0660
124 V B 0.0000
125 T B 0.3675
126 V B -0.5911
127 S B -0.3947
128 S B -0.4951
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5484 2.2505 View CSV PDB
4.5 -0.5749 2.2239 View CSV PDB
5.0 -0.6037 2.1891 View CSV PDB
5.5 -0.6299 2.1512 View CSV PDB
6.0 -0.6492 2.1252 View CSV PDB
6.5 -0.6591 2.1138 View CSV PDB
7.0 -0.6612 2.1084 View CSV PDB
7.5 -0.6587 2.1064 View CSV PDB
8.0 -0.6533 2.1058 View CSV PDB
8.5 -0.6444 2.1056 View CSV PDB
9.0 -0.6303 2.1055 View CSV PDB