Project name: VAAV_R5

Status: done

Started: 2026-08-21 03:20:27
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTVTVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYAARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:58)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2ade689d0b8f7d7/tmp/folded.pdb                (00:01:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:52)
Show buried residues

Minimal score value
-2.6554
Maximal score value
2.1584
Average score
-0.5266
Total score value
-130.6085

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.6940
2 V A 0.0000
3 Q A -2.0646
4 L A 0.0000
5 Q A -1.8518
6 E A 0.0000
7 S A -0.6988
8 G A -0.4219
9 P A -0.0518
10 G A 0.2489
11 L A 0.7557
12 V A 0.0000
13 K A -1.6802
14 P A -1.3180
15 S A -1.4540
16 Q A -1.9895
17 T A -1.7248
18 L A 0.0000
19 S A -0.9554
20 L A 0.0000
21 T A -0.5873
22 V A 0.0000
23 T A -1.2328
24 V A 0.0000
25 S A -1.3975
26 G A -1.4337
27 G A -1.1025
28 S A -0.6736
29 I A 0.0000
30 S A -0.2519
31 S A -0.3274
32 G A -0.0462
33 D A 0.1476
34 Y A 0.7110
35 Y A 0.5919
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A 0.0000
41 Q A 0.0000
42 P A -0.7142
43 P A -0.6777
44 G A -1.1312
45 C A -1.2332
46 K A -2.0526
47 G A -1.2779
48 L A 0.0000
49 E A -0.7779
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1151
54 I A 0.0000
55 Y A 0.2911
56 Y A 0.3154
57 S A -0.0928
58 G A -0.2279
59 S A -0.2722
60 T A -0.2773
61 D A -0.7545
62 Y A -0.7271
63 N A -0.9320
64 P A -1.1374
65 S A -0.9963
66 L A 0.0000
67 K A -2.1215
68 S A -1.5090
69 R A -1.8438
70 V A 0.0000
71 T A -1.1405
72 M A 0.0000
73 S A -0.3168
74 V A -0.3387
75 D A -1.1742
76 T A -1.0317
77 S A -1.3377
78 K A -2.1679
79 N A -1.4404
80 Q A -1.2511
81 F A 0.0000
82 S A -0.4701
83 L A 0.0000
84 K A -1.5327
85 V A 0.0000
86 N A -2.1708
87 S A -1.7050
88 V A 0.0000
89 T A -0.6980
90 A A -0.2736
91 A A -0.0352
92 D A 0.0000
93 T A 0.2636
94 A A 0.0000
95 V A 0.2399
96 Y A 0.0000
97 Y A 0.0000
98 A A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.9221
103 I A 1.8879
104 F A 2.1584
105 G A 1.0465
106 V A 0.9211
107 G A 0.7728
108 T A 0.0000
109 F A 0.0000
110 D A -0.5724
111 Y A -0.5580
112 W A -0.7919
113 G A 0.0000
114 Q A -1.6076
115 G A -0.7253
116 T A -0.1822
117 L A 0.8031
118 V A 0.0000
119 T A 0.2898
120 V A 0.0000
121 S A -0.3412
122 S A -0.6435
123 A A -0.5885
124 A A -0.3506
125 G A -0.8393
126 G A -1.0818
127 G A -1.1452
128 G A -1.1817
129 S A -1.0287
130 G A -1.1698
131 G A -1.2109
132 G A -1.1915
133 G A -1.1963
134 S A -1.0416
135 G A -1.1261
136 G A -1.1918
137 G A -1.2306
138 G A -1.1576
139 S A -0.9080
140 D A -0.8993
141 I A -0.0170
142 V A 1.1468
143 M A 0.0000
144 T A -0.2946
145 Q A -0.3736
146 S A -0.4905
147 P A -0.2875
148 A A -0.3061
149 T A -0.4334
150 L A -0.1834
151 S A -0.3582
152 L A -0.6689
153 S A -0.9730
154 P A -1.4346
155 G A -1.7687
156 E A -2.3468
157 R A -2.6554
158 A A 0.0000
159 T A -0.6513
160 L A 0.0000
161 S A -0.7540
162 A A 0.0000
163 R A -1.6456
164 A A 0.0000
165 S A -0.7112
166 Q A -1.5409
167 S A -1.2582
168 V A 0.0000
169 S A -0.5788
170 S A -0.0727
171 Y A 0.7742
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4281
179 P A -0.8735
180 G A -0.9679
181 C A -1.1122
182 Q A -1.5204
183 A A -1.1407
184 P A 0.0000
185 R A -1.4802
186 L A -0.6524
187 L A 0.0000
188 I A 0.0000
189 Y A -0.2001
190 D A -0.3386
191 A A 0.0000
192 S A -0.9077
193 N A -1.2848
194 R A -1.3978
195 A A -0.9312
196 T A -0.5875
197 G A -0.6547
198 I A 0.0000
199 P A -0.4245
200 A A -0.3575
201 R A -0.6742
202 F A 0.0000
203 S A -0.6788
204 G A -0.7056
205 S A -0.9320
206 G A -1.3541
207 S A -1.1567
208 G A -1.3667
209 T A -1.8761
210 D A -2.5977
211 F A 0.0000
212 T A -0.8122
213 L A 0.0000
214 T A -0.5900
215 I A 0.0000
216 S A -1.3194
217 S A -1.6860
218 L A 0.0000
219 E A -2.1067
220 P A -1.3434
221 E A -2.0828
222 D A 0.0000
223 F A -0.6418
224 A A 0.0000
225 V A -0.5908
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.2968
232 G A 0.0851
233 S A -0.2106
234 T A -0.3880
235 P A -0.4026
236 L A 0.0000
237 T A 0.1756
238 F A 0.2530
239 G A 0.0000
240 G A -0.8090
241 G A -0.7497
242 T A 0.0000
243 K A -0.9609
244 A A 0.0000
245 E A -0.4697
246 I A 0.7666
247 K A -0.9023
248 A A -0.3565
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4345 5.1628 View CSV PDB
4.5 -0.4567 5.1574 View CSV PDB
5.0 -0.4826 5.1438 View CSV PDB
5.5 -0.5065 5.1169 View CSV PDB
6.0 -0.5223 5.0778 View CSV PDB
6.5 -0.5253 5.0316 View CSV PDB
7.0 -0.5157 4.9827 View CSV PDB
7.5 -0.4978 4.9329 View CSV PDB
8.0 -0.4752 4.8828 View CSV PDB
8.5 -0.4491 4.8328 View CSV PDB
9.0 -0.4199 4.7833 View CSV PDB