Project name: e3849a9058c7c93 [mutate: VA3A, AR4A, AA5A, WA6A, TA7A, LA8A, VR19A, IA64A, PA65A, LR66A, PR67A, VR68A, WA70A, WA72A, PA73A, WA74A, IA86A, FA92A, LA99A, IA104A, LA112A, VA178A, LR179A, FR180A, IA189A, LR190A, IA210A, AR211A, AA212A, AA213A, LR214A, AA215A, AA222A, YA223A, IR224A, PR225A, LR226A, PR227A, VR228A, WA230A, WR232A, AR233A, AR234A, YR235A, LR236A, PA237A, VR238A, WA240A, WA242A, PA243A, WA244A, AA245A, AA246A, YR247A, MA248A, AA249A, IA252A, VA253A, AA256A, AR257A, YR258A, LR259A, VR260A, LR261A, ER262A, VR263A, PA264A, TA265A, LA266A, AR269A, YR270A, SR271A, VR272A, VA277A, FA278A]

Status: done

Started: 2026-04-15 04:24:01
Chain sequence(s) A: AKVAAWTLKAAACEAAAKVARAGGNSDATAGPGPGQADWDTGHRIDTAGPREGPGPGERVNGRIPLPVDWRWPWGGPGPGDDYEGIGGHESFRGPGPGLAAGSIKPIRGDILELRWHEANGPGPGSIKPIRGDILELRWHGPGPGRNTIERISRRFGIRVGPGPGELRWHEANNHFRVLFGPGPGRGDILELRWHEANNHGPGPGATAEIAAALAARQADAAYIPLPVDWRWAAYLPVDWRWPWAAYMADRIVARAAYLVLEVPTLRAAYSVDGRPVFK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues AA256A,AR257A,LA112A,IA252A,WR232A,VR19A,AR233A,PA243A,YR258A,LR259A,AA212A,AA213A,IA210A,AR211A,LA99A,LR214A,AA215A,YR270A,AA245A,VA253A,VR238A,VR272A,LR179A,VA178A,WA74A,PA73A,WA72A,WA70A,VA277A,VA3A,AA5A,AR4A,TA7A,WA6A,LA8A,FA92A,AR269A,FR180A,PA264A,WA240A,IA104A,WA242A,IA86A,WA244A,YR247A,AA246A,AA249A,MA248A,IA189A,PR227A,LR226A,PR225A,IR224A,YA223A,AA222A,VR263A,ER262A,LR261A,VR260A,LA266A,TA265A,VR228A,AR234A,VR68A,WA230A,YR235A,IA64A,PA65A,LR66A,PR67A,LR236A,FA278A,PA237A,LR190A,SR271A
Energy difference between WT (input) and mutated protein (by FoldX) 14.723 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:01:40)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:21:51)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2c402b656ef1695/tmp/folded.pdb                (00:21:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:23:06)
Show buried residues

Minimal score value
-5.6169
Maximal score value
0.0
Average score
-2.1008
Total score value
-586.1271

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 A A -1.3540
2 K A -2.1983
3 A A -1.7677 mutated: VA3A
4 R A -2.4998 mutated: AR4A
5 A A -1.7632 mutated: AA5A
6 A A -1.4484 mutated: WA6A
7 A A -1.1912 mutated: TA7A
8 A A -1.2435 mutated: LA8A
9 K A -1.9343
10 A A -1.1560
11 A A -0.8392
12 A A -0.9422
13 C A -0.9679
14 E A -2.4149
15 A A -1.8574
16 A A -1.7213
17 A A -2.3015
18 K A -3.6283
19 R A -3.6004 mutated: VR19A
20 A A -2.6765
21 R A -3.3854
22 A A -2.5378
23 G A -2.3833
24 G A -2.2751
25 N A -2.4069
26 S A -1.9266
27 D A -2.2404
28 A A -1.0756
29 T A -0.6337
30 A A -0.4776
31 G A -0.7070
32 P A -0.8047
33 G A -0.9127
34 P A -1.0589
35 G A -1.4873
36 Q A -1.7551
37 A A -1.4659
38 D A -1.9646
39 W A -0.6883
40 D A -2.0835
41 T A -1.3691
42 G A -1.6485
43 H A -2.0275
44 R A -2.1186
45 I A -0.0771
46 D A -1.4575
47 T A -0.7956
48 A A -0.7739
49 G A -1.4369
50 P A -1.9449
51 R A -3.1154
52 E A -3.1881
53 G A -2.1292
54 P A -1.7544
55 G A -1.5432
56 P A -1.5368
57 G A -1.8801
58 E A -2.8795
59 R A -2.8091
60 V A -0.8595
61 N A -1.8635
62 G A -2.1026
63 R A -2.5825
64 A A -1.8139 mutated: IA64A
65 A A -2.4240 mutated: PA65A
66 R A -3.5619 mutated: LR66A
67 R A -3.9427 mutated: PR67A
68 R A -4.0459 mutated: VR68A
69 D A -3.3411
70 A A -2.1601 mutated: WA70A
71 R A -2.3579
72 A A -1.0647 mutated: WA72A
73 A A -0.5385 mutated: PA73A
74 A A -0.4537 mutated: WA74A
75 G A -0.7593
76 G A -0.9400
77 P A -0.9187
78 G A -1.3135
79 P A -1.5537
80 G A -1.9246
81 D A -2.9128
82 D A -2.7261
83 Y A -1.1415
84 E A -2.3802
85 G A -1.3836
86 A A -1.1500 mutated: IA86A
87 G A -1.5619
88 G A -1.7014
89 H A -2.2576
90 E A -3.0486
91 S A -1.9051
92 A A -1.6710 mutated: FA92A
93 R A -2.4800
94 G A -1.6399
95 P A -1.1904
96 G A -1.1766
97 P A -0.9752
98 G A -1.0243
99 A A -0.7842 mutated: LA99A
100 A A -0.8796
101 A A -0.7684
102 G A -1.1339
103 S A -1.0830
104 A A -0.8784 mutated: IA104A
105 K A -1.6758
106 P A -1.5245
107 I A -1.4970
108 R A -2.5781
109 G A -2.0510
110 D A -2.5502
111 I A -1.6834
112 A A -1.1966 mutated: LA112A
113 E A 0.0000
114 L A -0.9510
115 R A -1.8607
116 W A 0.0000
117 H A -1.7326
118 E A -1.8626
119 A A -1.4742
120 N A -1.9744
121 G A -1.7071
122 P A -1.4102
123 G A -1.3918
124 P A -1.5331
125 G A 0.0000
126 S A -1.6512
127 I A 0.0000
128 K A -1.4778
129 P A -0.8571
130 I A -0.2615
131 R A -2.0602
132 G A -1.6941
133 D A -2.1630
134 I A -0.9139
135 L A -0.5037
136 E A -1.0127
137 L A -1.1497
138 R A -2.3827
139 W A -1.6182
140 H A -1.8161
141 G A -1.4616
142 P A -1.0077
143 G A -1.3895
144 P A -1.3158
145 G A -1.8196
146 R A -2.9488
147 N A -2.7631
148 T A -2.0379
149 I A 0.0000
150 E A -2.9949
151 R A -2.5386
152 I A 0.0000
153 S A 0.0000
154 R A -3.1773
155 R A -2.7031
156 F A -1.2070
157 G A -1.6176
158 I A -1.5676
159 R A -1.5965
160 V A -0.2719
161 G A -0.2788
162 P A -0.5602
163 G A -0.7575
164 P A -1.6321
165 G A -2.3058
166 E A 0.0000
167 L A 0.0000
168 R A -2.1434
169 W A -2.1668
170 H A -2.8534
171 E A -3.0378
172 A A -1.8686
173 N A -2.1200
174 N A -2.5301
175 H A -2.0698
176 F A -1.8719
177 R A -2.3975
178 A A -2.1868 mutated: VA178A
179 R A -3.8325 mutated: LR179A
180 R A -3.7246 mutated: FR180A
181 G A -3.1289
182 P A -2.1212
183 G A -1.4036
184 P A -1.4343
185 G A -2.0166
186 R A -3.0826
187 G A -3.0368
188 D A -3.7401
189 A A -3.0245 mutated: IA189A
190 R A -4.0044 mutated: LR190A
191 E A -3.2176
192 L A -1.9255
193 R A -2.4608
194 W A -1.3592
195 H A -2.1278
196 E A -3.0374
197 A A -2.0574
198 N A -3.0107
199 N A -2.7645
200 H A -2.5116
201 G A -1.7006
202 P A -1.2653
203 G A -0.9578
204 P A -0.7383
205 G A -1.0720
206 A A -1.2030
207 T A -1.3564
208 A A -1.6374
209 E A -2.6947
210 A A -2.2601 mutated: IA210A
211 R A -2.9626 mutated: AR211A
212 A A -2.2131 mutated: AA212A
213 A A -2.4714 mutated: AA213A
214 R A -3.5622 mutated: LR214A
215 A A -2.4439 mutated: AA215A
216 A A -2.3660
217 R A -3.4943
218 Q A -2.9844
219 A A -2.1417
220 D A -2.8169
221 A A -1.9073
222 A A -1.5079 mutated: AA222A
223 A A -1.7427 mutated: YA223A
224 R A -3.5567 mutated: IR224A
225 R A -4.2810 mutated: PR225A
226 R A -4.6240 mutated: LR226A
227 R A -4.3871 mutated: PR227A
228 R A -4.0756 mutated: VR228A
229 D A -3.1502
230 A A -3.0345 mutated: WA230A
231 R A -4.4379
232 R A -5.2607 mutated: WR232A
233 R A -4.9196 mutated: AR233A
234 R A -5.2676 mutated: AR234A
235 R A -5.2356 mutated: YR235A
236 R A -4.6121 mutated: LR236A
237 A A -2.9095 mutated: PA237A
238 R A -3.4272 mutated: VR238A
239 D A -2.5770
240 A A -1.7595 mutated: WA240A
241 R A -2.3105
242 A A -1.3892 mutated: WA242A
243 A A -0.7354 mutated: PA243A
244 A A -0.7130 mutated: WA244A
245 A A -1.5238 mutated: AA245A
246 A A -1.8985 mutated: AA246A
247 R A -2.2167 mutated: YR247A
248 A A -1.7244 mutated: MA248A
249 A A -2.5700 mutated: AA249A
250 D A -3.2866
251 R A -3.6293
252 A A -2.6192 mutated: IA252A
253 A A -2.3941 mutated: VA253A
254 A A -2.9620
255 R A -4.1594
256 A A -3.5853 mutated: AA256A
257 R A -4.6451 mutated: AR257A
258 R A -4.8887 mutated: YR258A
259 R A -5.6169 mutated: LR259A
260 R A -5.5883 mutated: VR260A
261 R A -5.5065 mutated: LR261A
262 R A -5.1699 mutated: ER262A
263 R A -4.2046 mutated: VR263A
264 A A -2.0797 mutated: PA264A
265 A A -1.1835 mutated: TA265A
266 A A -1.4921 mutated: LA266A
267 R A -2.6340
268 A A -2.3786
269 R A -3.8798 mutated: AR269A
270 R A -4.6904 mutated: YR270A
271 R A -4.7915 mutated: SR271A
272 R A -4.0613 mutated: VR272A
273 D A -3.0805
274 G A -3.0306
275 R A -3.2041
276 P A -2.0430
277 A A -1.4405 mutated: VA277A
278 A A -1.0224 mutated: FA278A
279 K A -1.6863
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -2.2986 3.85 View CSV PDB
4.5 -2.3736 3.6056 View CSV PDB
5.0 -2.4622 3.2621 View CSV PDB
5.5 -2.5475 2.8659 View CSV PDB
6.0 -2.6151 2.5105 View CSV PDB
6.5 -2.66 2.5105 View CSV PDB
7.0 -2.6881 2.5105 View CSV PDB
7.5 -2.7086 2.5105 View CSV PDB
8.0 -2.725 2.5105 View CSV PDB
8.5 -2.7352 2.5105 View CSV PDB
9.0 -2.7361 2.5105 View CSV PDB