Project name: 2d3618e47d52d13

Status: done

Started: 2026-05-19 02:25:12
Chain sequence(s) A: SQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATMGDSGYSTLTFGKGTMLLVSPGGGSEGGGSEGGGSEGGGSEGGTGNAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPMGGSYEQYFGPGTRLTVT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:10)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:10)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:10)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:10)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:11)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:11)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:54)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2d3618e47d52d13/tmp/folded.pdb                (00:01:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:47)
Show buried residues

Minimal score value
-3.3875
Maximal score value
1.5521
Average score
-0.8319
Total score value
-207.1395

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -1.3119
2 Q A -2.4250
3 Q A -2.6874
4 G A -2.5693
5 E A -3.3241
6 E A -3.2030
7 D A -3.1014
8 P A -2.0743
9 Q A -1.9343
10 A A -0.3425
11 L A 0.3405
12 S A 0.0609
13 I A -1.0235
14 Q A -2.2074
15 E A -2.6380
16 G A -2.4178
17 E A -2.9239
18 N A -2.4412
19 A A 0.0000
20 T A -0.7496
21 M A 0.0000
22 N A -1.5331
23 C A 0.0000
24 S A -1.9044
25 Y A 0.0000
26 K A -2.2211
27 T A -1.2831
28 S A -1.1626
29 I A 0.0000
30 N A -1.6269
31 N A 0.0000
32 L A 0.0000
33 Q A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 R A -0.2043
37 Q A -0.7667
38 N A -1.1642
39 S A -1.2712
40 G A -1.9347
41 R A -2.2154
42 G A 0.0000
43 L A 0.0000
44 V A 0.7654
45 H A 0.4782
46 L A 0.4671
47 I A 0.0000
48 L A -0.2946
49 I A 0.0000
50 R A -2.1724
51 S A -2.0889
52 N A -2.4850
53 E A -2.7731
54 R A -3.3875
55 E A -3.3458
56 K A -2.5077
57 H A -2.0897
58 S A -1.2060
59 G A -1.1682
60 R A -1.2947
61 L A -0.9973
62 R A -1.7729
63 V A 0.0000
64 T A -1.9091
65 L A 0.0000
66 D A -2.2008
67 T A -1.9145
68 S A -1.4838
69 K A -2.5119
70 K A -2.2116
71 S A -1.6386
72 S A 0.0000
73 S A -0.9069
74 L A 0.0000
75 L A -0.7281
76 I A 0.0000
77 T A -1.4051
78 A A -1.7851
79 S A 0.0000
80 R A -2.1391
81 A A -0.9384
82 A A -0.4447
83 D A 0.0000
84 T A -0.0443
85 A A 0.0000
86 S A -0.2508
87 Y A 0.0000
88 F A 0.0000
89 C A 0.0000
90 A A 0.0000
91 T A 0.0000
92 M A 0.0000
93 G A -1.2038
94 D A -2.1400
95 S A -1.1398
96 G A -0.7938
97 Y A 0.5251
98 S A 0.2399
99 T A 0.2430
100 L A 0.0000
101 T A -0.7283
102 F A 0.0000
103 G A 0.0000
104 K A -1.9369
105 G A -1.1836
106 T A 0.0000
107 M A 0.0782
108 L A 0.0000
109 L A 0.5201
110 V A 0.0000
111 S A -1.0031
112 P A -1.3416
113 G A -1.8143
114 G A -1.4805
115 G A -1.4532
116 S A -1.6582
117 E A -2.5173
118 G A -1.8128
119 G A -1.6935
120 G A -1.5635
121 S A -1.6045
122 E A -2.4644
123 G A -1.8216
124 G A -1.4527
125 G A -1.5608
126 S A -1.6506
127 E A -2.4314
128 G A -1.8397
129 G A -1.6949
130 G A -1.6052
131 S A -1.7120
132 E A -2.4588
133 G A -1.7913
134 G A -1.4811
135 T A -1.2429
136 G A -0.7799
137 N A -0.5409
138 A A -0.3830
139 G A -1.0524
140 V A 0.0000
141 T A -0.6152
142 Q A 0.0000
143 T A -0.7837
144 P A -0.8514
145 K A -1.5159
146 F A 0.2927
147 Q A 0.2431
148 V A 0.7926
149 L A 0.0000
150 K A -1.8783
151 T A -1.3421
152 G A -1.2945
153 Q A -1.3744
154 S A -0.8477
155 M A -0.4899
156 T A -0.7858
157 L A 0.0000
158 Q A -0.7332
159 C A 0.0000
160 A A -0.9948
161 Q A 0.0000
162 D A -2.3887
163 M A -1.4522
164 N A -1.9566
165 H A 0.0000
166 E A -0.7437
167 Y A 0.2183
168 M A 0.0000
169 S A 0.0000
170 W A 0.0000
171 Y A 0.0000
172 R A 0.0000
173 Q A -0.5561
174 D A -0.4638
175 P A -0.4963
176 G A -1.0927
177 M A -0.9188
178 G A 0.0000
179 L A 0.0000
180 R A -0.9843
181 L A 0.0000
182 I A 0.0000
183 H A 0.0000
184 Y A 0.0000
185 S A 0.0000
186 V A 0.7473
187 G A 0.3968
188 A A 0.0434
189 G A 0.4173
190 I A 1.5521
191 T A -0.0491
192 D A -1.3339
193 Q A -2.2529
194 G A -1.5379
195 E A -1.6034
196 V A -0.9067
197 P A -1.5736
198 N A -1.6945
199 G A -1.1162
200 Y A 0.0000
201 N A -1.9375
202 V A -1.1713
203 S A -0.5857
204 R A 0.0000
205 S A -0.3554
206 T A -0.7486
207 T A -1.3194
208 E A -1.9546
209 D A -1.3062
210 F A 0.0000
211 P A -0.8786
212 L A 0.0000
213 R A -1.7307
214 L A 0.0000
215 L A -0.5425
216 S A -0.7697
217 A A 0.0000
218 A A -0.7265
219 P A -0.6816
220 S A -0.3793
221 Q A 0.0000
222 T A -0.3522
223 S A 0.0000
224 V A -0.4238
225 Y A 0.0000
226 F A 0.0000
227 C A 0.0000
228 A A 0.0000
229 S A 0.0000
230 S A 0.0000
231 P A -0.0780
232 M A 0.5440
233 G A -0.2671
234 G A -0.4767
235 S A -0.1825
236 Y A 0.2252
237 E A -0.1905
238 Q A 0.0000
239 Y A 0.5109
240 F A 0.0000
241 G A 0.0000
242 P A -1.2706
243 G A 0.0000
244 T A 0.0000
245 R A -1.4203
246 L A 0.0000
247 T A -0.0572
248 V A 0.0000
249 T A -0.6156
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6271 2.8628 View CSV PDB
4.5 -0.6688 2.8242 View CSV PDB
5.0 -0.7222 2.7719 View CSV PDB
5.5 -0.7782 2.713 View CSV PDB
6.0 -0.8266 2.6515 View CSV PDB
6.5 -0.859 2.5892 View CSV PDB
7.0 -0.8735 2.5267 View CSV PDB
7.5 -0.8746 2.4644 View CSV PDB
8.0 -0.8678 2.4031 View CSV PDB
8.5 -0.8555 2.3446 View CSV PDB
9.0 -0.838 2.2937 View CSV PDB