Chain sequence(s) |
A: EVQLVQSGAEVKKPGASVKVSCKASGYTFASYSMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARFPSRYWGQGTLVTVSS
input PDB |
Selected Chain(s) | A |
Distance of aggregation | 10 Å |
FoldX usage | Yes |
pH calculations | No |
alphaCutter usage | No |
Dynamic mode | No |
Automated mutations | Yes |
Downloads | Download all the data |
Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01) [WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow to prevent this behavior) (00:00:01) [INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01) [INFO] runJob: Creating pdb object from: input.pdb (00:00:01) [INFO] FoldX: Starting FoldX energy minimization (00:00:01) [INFO] Analysis: Starting Aggrescan4D on folded.pdb (00:01:20) [INFO] AutoMutEv:Residue number 109 from chain A and a score of 1.088 (leucine) selected for automated mutation (00:01:20) [INFO] AutoMutEv:Residue number 11 from chain A and a score of 1.044 (valine) selected for automated mutation (00:01:20) [INFO] AutoMutEv:Residue number 93 from chain A and a score of 0.752 (valine) selected for automated mutation (00:01:20) [INFO] AutoMutEv:Residue number 45 from chain A and a score of 0.714 (leucine) selected for automated mutation (00:01:20) [INFO] AutoMutEv:Residue number 47 from chain A and a score of 0.497 (tryptophan) selected for automated mutation (00:01:20) [INFO] AutoMutEv:Residue number 95 from chain A and a score of 0.430 (tyrosine) selected for automated mutation (00:01:20) [INFO] AutoMutEv:Mutating residue number 109 from chain A (leucine) into methionine (00:01:20) [INFO] AutoMutEv:Mutating residue number 11 from chain A (valine) into threonine (00:01:20) [INFO] AutoMutEv:Mutating residue number 11 from chain A (valine) into alanine (00:01:20) [INFO] AutoMutEv:Mutating residue number 11 from chain A (valine) into methionine (00:01:25) [INFO] AutoMutEv:Mutating residue number 93 from chain A (valine) into threonine (00:01:26) [INFO] AutoMutEv:Mutating residue number 93 from chain A (valine) into alanine (00:01:28) [INFO] AutoMutEv:Mutating residue number 93 from chain A (valine) into methionine (00:01:30) [INFO] AutoMutEv:Mutating residue number 45 from chain A (leucine) into methionine (00:01:31) [INFO] AutoMutEv:Mutating residue number 47 from chain A (tryptophan) into arginine (00:01:35) [INFO] AutoMutEv:Mutating residue number 95 from chain A (tyrosine) into histidine (00:01:37) [INFO] AutoMutEv:Mutating residue number 95 from chain A (tyrosine) into cysteine (00:01:37) [INFO] AutoMutEv:Mutating residue number 95 from chain A (tyrosine) into tryptophan (00:01:44) [INFO] AutoMutEv:Effect of mutation residue number 109 from chain A (leucine) into methionine: Energy difference: -0.2275 kcal/mol, Difference in average score from the base case: -0.0261 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 11 from chain A (valine) into threonine: Energy difference: 0.0972 kcal/mol, Difference in average score from the base case: -0.0553 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 11 from chain A (valine) into alanine: Energy difference: 0.1658 kcal/mol, Difference in average score from the base case: -0.0552 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 11 from chain A (valine) into methionine: Energy difference: -0.7929 kcal/mol, Difference in average score from the base case: -0.0297 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 93 from chain A (valine) into threonine: Energy difference: 0.5979 kcal/mol, Difference in average score from the base case: -0.0146 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 93 from chain A (valine) into alanine: Energy difference: 1.0441 kcal/mol, Difference in average score from the base case: -0.0228 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 93 from chain A (valine) into methionine: Energy difference: -0.4050 kcal/mol, Difference in average score from the base case: -0.0253 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 45 from chain A (leucine) into methionine: Energy difference: 0.3316 kcal/mol, Difference in average score from the base case: -0.0139 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 47 from chain A (tryptophan) into arginine: Energy difference: 2.4809 kcal/mol, Difference in average score from the base case: -0.0542 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 95 from chain A (tyrosine) into histidine: Energy difference: 1.7731 kcal/mol, Difference in average score from the base case: -0.0136 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 95 from chain A (tyrosine) into cysteine: Energy difference: 2.4917 kcal/mol, Difference in average score from the base case: -0.0074 (00:01:53) [INFO] AutoMutEv:Effect of mutation residue number 95 from chain A (tyrosine) into tryptophan: Energy difference: 0.4869 kcal/mol, Difference in average score from the base case: -0.0008 (00:01:53) [INFO] Main: Simulation completed successfully. (00:01:57) |
The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.
residue index | residue name | chain | Aggrescan4D score | mutation |
---|---|---|---|---|
1 | E | A | -2.1473 | |
2 | V | A | -1.2698 | |
3 | Q | A | -1.4958 | |
4 | L | A | 0.0000 | |
5 | V | A | -0.0594 | |
6 | Q | A | 0.0000 | |
7 | S | A | -0.5145 | |
8 | G | A | -0.4447 | |
9 | A | A | 0.3656 | |
10 | E | A | 0.1743 | |
11 | V | A | 1.0442 | |
12 | K | A | -0.9094 | |
13 | K | A | -2.1405 | |
14 | P | A | -2.1925 | |
15 | G | A | -1.5143 | |
16 | A | A | -1.2089 | |
17 | S | A | -1.2841 | |
18 | V | A | 0.0000 | |
19 | K | A | -1.7536 | |
20 | V | A | 0.0000 | |
21 | S | A | -0.6467 | |
22 | C | A | 0.0000 | |
23 | K | A | -1.2497 | |
24 | A | A | 0.0000 | |
25 | S | A | -1.0876 | |
26 | G | A | -1.2614 | |
27 | Y | A | -0.4601 | |
28 | T | A | -0.0479 | |
29 | F | A | 0.0000 | |
30 | A | A | -0.3260 | |
31 | S | A | -0.1363 | |
32 | Y | A | 0.2168 | |
33 | S | A | -0.0089 | |
34 | M | A | 0.0000 | |
35 | H | A | 0.3302 | |
36 | W | A | 0.0000 | |
37 | V | A | 0.0000 | |
38 | R | A | 0.0973 | |
39 | Q | A | -0.3348 | |
40 | A | A | -0.9001 | |
41 | P | A | -1.1773 | |
42 | G | A | -1.1951 | |
43 | Q | A | -1.6038 | |
44 | G | A | -0.6749 | |
45 | L | A | 0.7136 | |
46 | E | A | 0.1398 | |
47 | W | A | 0.4970 | |
48 | M | A | 0.0000 | |
49 | G | A | 0.0000 | |
50 | I | A | 0.3282 | |
51 | I | A | 0.0000 | |
52 | N | A | -0.9144 | |
53 | P | A | 0.0000 | |
54 | S | A | -0.7563 | |
55 | G | A | -0.9418 | |
56 | G | A | -0.9274 | |
57 | S | A | -0.6675 | |
58 | T | A | -0.3030 | |
59 | S | A | -0.3470 | |
60 | Y | A | -0.6473 | |
61 | A | A | -1.1498 | |
62 | Q | A | -2.4178 | |
63 | K | A | -2.6142 | |
64 | F | A | 0.0000 | |
65 | Q | A | -2.3365 | |
66 | G | A | -1.5641 | |
67 | R | A | -1.3047 | |
68 | V | A | 0.0000 | |
69 | T | A | -0.8278 | |
70 | M | A | 0.0000 | |
71 | T | A | -0.6585 | |
72 | R | A | -1.1851 | |
73 | D | A | -1.1765 | |
74 | T | A | -0.7102 | |
75 | S | A | -0.5485 | |
76 | T | A | -0.7079 | |
77 | S | A | -0.8056 | |
78 | T | A | 0.0000 | |
79 | V | A | 0.0000 | |
80 | Y | A | -0.7590 | |
81 | M | A | 0.0000 | |
82 | E | A | -1.5141 | |
83 | L | A | 0.0000 | |
84 | S | A | -1.0750 | |
85 | S | A | -1.1268 | |
86 | L | A | 0.0000 | |
87 | R | A | -2.7573 | |
88 | S | A | -2.2516 | |
89 | E | A | -2.4807 | |
90 | D | A | 0.0000 | |
91 | T | A | -0.6966 | |
92 | A | A | 0.0000 | |
93 | V | A | 0.7522 | |
94 | Y | A | 0.0000 | |
95 | Y | A | 0.4300 | |
96 | C | A | 0.0000 | |
97 | A | A | 0.0000 | |
98 | R | A | 0.0000 | |
99 | F | A | 0.0114 | |
100 | P | A | -0.4214 | |
101 | S | A | -0.6817 | |
102 | R | A | -1.4717 | |
103 | Y | A | -0.5057 | |
104 | W | A | -0.0283 | |
105 | G | A | 0.0000 | |
106 | Q | A | -0.8084 | |
107 | G | A | -0.0844 | |
108 | T | A | 0.0000 | |
109 | L | A | 1.0883 | |
110 | V | A | 0.0000 | |
111 | T | A | -0.0155 | |
112 | V | A | 0.0000 | |
113 | S | A | -1.0575 | |
114 | S | A | -0.7783 |
Automated mutations analysis - evolutionary conserved mutations
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated based off an evolutionary approach.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file .
Mutant |
Energetic effect |
Score comparison |
|||
VM11A | -0.7929 | -0.0297 | View | CSV | PDB |
VM93A | -0.405 | -0.0253 | View | CSV | PDB |
LM109A | -0.2275 | -0.0261 | View | CSV | PDB |
VT11A | 0.0972 | -0.0553 | View | CSV | PDB |
LM45A | 0.3316 | -0.0139 | View | CSV | PDB |
VT93A | 0.5979 | -0.0146 | View | CSV | PDB |
WR47A | 2.4809 | -0.0542 | View | CSV | PDB |
YH95A | 1.7731 | -0.0136 | View | CSV | PDB |
YC95A | 2.4917 | -0.0074 | View | CSV | PDB |