Project name: TtMqnB N187D

Status: done

Started: 2026-07-14 11:06:04
Chain sequence(s) A: MGSSHHHHHHSSGENLYFQGGTMWLLLSPTRLEAPFLQGEPFAFLAWRGLKGPGFVYLETGIGKVNAAMALAAYAARNPVEKALLFGLAGAYPGGPSLGEAVLVEEEVEADLGLKEGLAPLGFPALALGERRYFNRFPLDPGLTGELARGLGLKVAVGLTRDLVSETPEEALALAQRWGASLENMEGAAFARACLALGVRGAELRAISDPAGVREKAHWRTKEALSALARAVRRLLAEEGGARRPPG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:07)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2dbeeaba5d61ee2/tmp/folded.pdb                (00:04:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:38)
Show buried residues

Minimal score value
-3.622
Maximal score value
1.9291
Average score
-0.7061
Total score value
-174.4081

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.7525
2 G A -0.2272
3 S A -0.6602
4 S A -1.1891
5 H A -2.0717
6 H A -2.4375
7 H A -2.6532
8 H A -2.6543
9 H A -2.4515
10 H A -2.1069
11 S A -1.6247
12 S A -1.6706
13 G A -1.7725
14 E A -1.9063
15 N A -0.8403
16 L A 1.2926
17 Y A 1.8829
18 F A 1.7643
19 Q A -0.1121
20 G A -0.5664
21 G A -0.8183
22 T A -0.6544
23 M A 0.0113
24 W A 0.0000
25 L A 0.0000
26 L A 0.0000
27 L A 0.0000
28 S A 0.0000
29 P A 0.0000
30 T A -0.3363
31 R A -1.5726
32 L A 0.2874
33 E A 0.0000
34 A A 0.0000
35 P A -0.4670
36 F A -0.7239
37 L A 0.0000
38 Q A -1.8928
39 G A -2.1509
40 E A -2.5802
41 P A -1.7639
42 F A -0.7909
43 A A -0.2483
44 F A 0.0000
45 L A 0.4710
46 A A 0.0952
47 W A -0.5777
48 R A -1.7555
49 G A 0.0000
50 L A -1.6532
51 K A -1.9972
52 G A -1.4345
53 P A -0.7909
54 G A -0.3068
55 F A 0.0000
56 V A 0.0000
57 Y A 0.0000
58 L A 0.0000
59 E A 0.0000
60 T A 0.0000
61 G A 0.0000
62 I A 1.7321
63 G A 0.0000
64 K A 0.6908
65 V A 1.8380
66 N A 1.3800
67 A A 0.0000
68 A A 0.7133
69 M A 1.1391
70 A A 0.0000
71 L A 0.0000
72 A A 0.1575
73 A A -0.1209
74 Y A 0.0000
75 A A -0.7187
76 A A -0.8379
77 R A -2.0547
78 N A -1.5820
79 P A -1.1759
80 V A -1.2292
81 E A -2.1433
82 K A -1.5152
83 A A 0.0000
84 L A 0.0000
85 L A 0.0000
86 F A 0.0000
87 G A 0.0000
88 L A 0.4159
89 A A 0.0000
90 G A 0.0000
91 A A 0.0000
92 Y A 0.0000
93 P A -0.5012
94 G A -0.5054
95 G A -0.4354
96 P A -0.4664
97 S A -0.3817
98 L A -0.3957
99 G A -1.0946
100 E A -0.8221
101 A A 0.0000
102 V A 0.0000
103 L A 0.0000
104 V A 0.0000
105 E A -1.6346
106 E A -1.1130
107 E A 0.0000
108 V A 0.0000
109 E A 0.0000
110 A A -1.4211
111 D A -1.7638
112 L A -0.8595
113 G A -0.3945
114 L A -0.8514
115 K A -2.7162
116 E A -2.7099
117 G A 0.0000
118 L A 0.0000
119 A A 0.4098
120 P A 0.1978
121 L A 1.4884
122 G A 1.0998
123 F A 1.9291
124 P A 0.5576
125 A A 0.2587
126 L A -0.1568
127 A A -0.9512
128 L A -1.1103
129 G A -1.8975
130 E A -3.1837
131 R A -3.4601
132 R A -2.5820
133 Y A 0.0000
134 F A 0.3607
135 N A 0.0000
136 R A -0.9352
137 F A 0.0000
138 P A -0.9297
139 L A 0.0000
140 D A -1.3341
141 P A -1.4749
142 G A -1.5038
143 L A 0.0000
144 T A 0.0000
145 G A -1.9836
146 E A -2.7861
147 L A 0.0000
148 A A 0.0000
149 R A -2.9211
150 G A -2.3155
151 L A 0.0000
152 G A -1.5869
153 L A -1.1199
154 K A -1.6518
155 V A -0.3590
156 A A 0.0000
157 V A -0.2415
158 G A 0.0000
159 L A 0.0000
160 T A 0.0000
161 R A 0.0000
162 D A -0.7915
163 L A 0.3351
164 V A 0.7272
165 S A 0.0000
166 E A -1.4637
167 T A -1.2947
168 P A -1.1948
169 E A -1.7629
170 E A -0.9834
171 A A 0.0000
172 L A 0.0743
173 A A -0.7752
174 L A -0.8105
175 A A -0.9948
176 Q A -1.7840
177 R A -2.6893
178 W A 0.0000
179 G A -1.2865
180 A A 0.0000
181 S A -0.2356
182 L A 0.0000
183 E A 0.0000
184 N A 0.0000
185 M A 0.5746
186 E A 0.0000
187 G A 0.0000
188 A A 0.0000
189 A A 0.0000
190 F A 0.0000
191 A A 0.0000
192 R A -0.2966
193 A A 0.2252
194 C A 0.0000
195 L A 0.1972
196 A A 0.5390
197 L A 0.4504
198 G A -0.5365
199 V A 0.0000
200 R A -1.7942
201 G A 0.0000
202 A A 0.0000
203 E A 0.0000
204 L A 0.0000
205 R A 0.0000
206 A A 0.0000
207 I A 0.0000
208 S A 0.0000
209 D A -1.1191
210 P A -0.9225
211 A A 0.0000
212 G A 0.0000
213 V A -1.6991
214 R A -3.2849
215 E A -3.6220
216 K A -3.3529
217 A A -2.0513
218 H A -2.2606
219 W A -2.1082
220 R A -2.0937
221 T A -1.7965
222 K A -2.5492
223 E A -2.4256
224 A A 0.0000
225 L A -1.0378
226 S A -1.4611
227 A A -1.4997
228 L A 0.0000
229 A A -1.6107
230 R A -2.6588
231 A A 0.0000
232 V A 0.0000
233 R A -3.0168
234 R A -2.8511
235 L A 0.0000
236 L A -1.4933
237 A A -1.8574
238 E A -2.8512
239 E A -1.9872
240 G A -2.1047
241 G A -2.0727
242 A A -2.1623
243 R A -3.2857
244 R A -3.0484
245 P A -1.8643
246 P A -1.2743
247 G A -0.9508
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6158 5.0395 View CSV PDB
4.5 -0.6656 5.0395 View CSV PDB
5.0 -0.7262 5.0395 View CSV PDB
5.5 -0.7836 5.0395 View CSV PDB
6.0 -0.8233 5.0395 View CSV PDB
6.5 -0.8381 5.0395 View CSV PDB
7.0 -0.8329 5.0395 View CSV PDB
7.5 -0.8177 5.0395 View CSV PDB
8.0 -0.7981 5.0395 View CSV PDB
8.5 -0.7755 5.0395 View CSV PDB
9.0 -0.7505 5.0395 View CSV PDB