Project name: 2ee473a59567ae1

Status: done

Started: 2026-06-05 21:13:24
Chain sequence(s) A: QVQLQESGGGLVQPGGSLRLSCAASGFSFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQLNGMRAQDTAVYYCARDKWVTSLDYWGQGTLVTVSS
B: QAVLTQPSSLSASPGASVSLTCTLRSGINVGAYRIYWYQQKPGSPPQFLLRYKSDSDKHQGSGVPSRFSGSRDASANAGILLISGLQSEDEADYYCAIRHSSVWVFGGGTKLTVL
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:56)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2ee473a59567ae1/tmp/folded.pdb                (00:01:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:02)
Show buried residues

Minimal score value
-2.898
Maximal score value
1.4227
Average score
-0.5869
Total score value
-136.7412

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.4381
2 V A -0.8044
3 Q A -1.4188
4 L A 0.0000
5 Q A -1.2610
6 E A 0.0000
7 S A -0.7710
8 G A -0.6355
9 G A 0.0733
10 G A 0.6171
11 L A 1.2916
12 V A 0.0000
13 Q A -1.4305
14 P A -1.6343
15 G A -1.4735
16 G A -1.0218
17 S A -1.1721
18 L A -1.0980
19 R A -2.2265
20 L A 0.0000
21 S A -0.7951
22 C A 0.0000
23 A A -0.8349
24 A A 0.0000
25 S A -1.2106
26 G A -1.0417
27 F A -0.4872
28 S A -0.3782
29 F A 0.0000
30 S A -0.7123
31 S A -0.3924
32 Y A -0.1209
33 A A 0.0000
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.6821
40 A A -0.9666
41 P A -0.8544
42 G A -1.5001
43 K A -2.2690
44 G A -1.4515
45 L A 0.0000
46 E A -0.8945
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 A A 0.0000
51 I A 0.0000
52 S A -0.4062
53 G A -0.5604
54 S A -0.7184
55 G A -0.7823
56 G A -0.7237
57 S A -0.4028
58 T A -0.0885
59 Y A -0.0918
60 Y A -0.7556
61 A A -1.2533
62 D A -2.4084
63 S A -1.6980
64 V A 0.0000
65 K A -2.5502
66 G A -1.7351
67 R A -1.3021
68 F A 0.0000
69 T A -0.8952
70 I A 0.0000
71 S A -0.5104
72 R A -1.0985
73 D A -1.6559
74 N A -1.8192
75 S A -1.6404
76 K A -2.4248
77 N A -1.8513
78 T A -1.2992
79 L A 0.0000
80 Y A -0.6201
81 L A 0.0000
82 Q A -1.5125
83 L A 0.0000
84 N A -1.4136
85 G A -1.2823
86 M A 0.0000
87 R A -2.1454
88 A A -1.4633
89 Q A -1.6091
90 D A 0.0000
91 T A -0.1946
92 A A 0.0000
93 V A 0.6712
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 D A 0.0000
100 K A -0.1014
101 W A 0.5908
102 V A 1.4165
103 T A 0.1560
104 S A 0.0000
105 L A 0.0000
106 D A -0.1810
107 Y A 0.1581
108 W A -0.2619
109 G A 0.0000
110 Q A -1.2972
111 G A 0.0000
112 T A 0.2156
113 L A 1.4227
114 V A 0.0000
115 T A 0.3402
116 V A 0.0000
117 S A -0.4740
118 S A -0.6850
1 Q B -1.4462
2 A B -0.7276
3 V B -0.4620
4 L B 0.0000
5 T B -0.6128
6 Q B -0.5677
7 P B -0.5842
8 S B -0.8499
9 S B -0.9168
10 L B -0.3444
11 S B -0.1173
12 A B 0.0273
13 S B -0.0398
14 P B -0.7798
15 G B -0.9701
16 A B -0.5973
17 S B -0.4599
18 V B 0.0523
19 S B 0.1244
20 L B 0.0000
21 T B -0.1917
22 C B 0.0000
23 T B -0.7422
24 L B 0.0000
25 R B -2.0970
26 S B -1.5590
27 G B -1.2815
28 I B 0.0000
29 N B -1.7126
30 V B 0.0000
31 G B -0.9101
32 A B -0.4582
33 Y B -0.4974
34 R B -0.7428
35 I B 0.0000
36 Y B 0.0000
37 W B 0.0000
38 Y B 0.0000
39 Q B 0.0000
40 Q B 0.0000
41 K B -2.1761
42 P B -1.2731
43 G B -1.0730
44 S B -1.1003
45 P B -0.8342
46 P B 0.0000
47 Q B -0.8062
48 F B 0.0000
49 L B 0.0000
50 L B 0.0000
51 R B 0.0000
52 Y B -1.6505
53 K B -1.6971
54 S B -1.9645
55 D B -2.5831
56 S B -1.7868
57 D B -2.0487
58 K B -2.8980
59 H B -1.8273
60 Q B -1.2822
61 G B 0.0000
62 S B -0.6997
63 G B -0.6266
64 V B -0.5139
65 P B -0.5437
66 S B -0.6306
67 R B -0.5683
68 F B 0.0000
69 S B -0.4164
70 G B 0.0000
71 S B -0.9779
72 R B -1.2993
73 D B -1.2297
74 A B -0.9431
75 S B -0.5802
76 A B -0.5288
77 N B -1.2787
78 A B 0.0000
79 G B 0.0000
80 I B -0.1315
81 L B 0.0000
82 L B 0.3929
83 I B 0.0000
84 S B -0.5987
85 G B -0.8285
86 L B 0.0000
87 Q B -1.8575
88 S B -1.6944
89 E B -2.7316
90 D B 0.0000
91 E B -2.3990
92 A B 0.0000
93 D B -1.5387
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 A B 0.0000
98 I B 0.0000
99 R B -0.3055
100 H B -0.4202
101 S B -0.4199
102 S B -0.2553
103 V B 0.0696
104 W B 0.0000
105 V B 0.1473
106 F B 0.0261
107 G B 0.0000
108 G B -1.0097
109 G B 0.0000
110 T B 0.0000
111 K B -2.1741
112 L B 0.0000
113 T B -0.6813
114 V B -0.2898
115 L B 1.1979
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7239 2.0935 View CSV PDB
4.5 -0.7483 2.0935 View CSV PDB
5.0 -0.7731 2.0935 View CSV PDB
5.5 -0.7934 2.0935 View CSV PDB
6.0 -0.8032 2.0935 View CSV PDB
6.5 -0.7993 2.0935 View CSV PDB
7.0 -0.7837 2.0935 View CSV PDB
7.5 -0.7609 2.0935 View CSV PDB
8.0 -0.7333 2.0935 View CSV PDB
8.5 -0.7008 2.0935 View CSV PDB
9.0 -0.6637 2.0935 View CSV PDB