Project name: 2f1c357a9aa4f29

Status: done

Started: 2025-02-21 07:10:27
Chain sequence(s) A: MASYQNRPGGQATDEYGNPIQQQYDEYGNPMGGGGYGTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQGYGTGTGTEGFGTGGGARHHGQEQLHKESGGGLGGMLHRSGSGSSSSSEDDGQGGRRKKGITQKIKEKLPGHHDQSGQAQAMGGMGSGYDAGGYGGEHHEKKGMMDKIKEKLPGGGR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-4.2868
Maximal score value
1.1839
Average score
-1.3224
Total score value
-245.9577

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 1.1839
2 A A 0.6579
3 S A 0.1914
4 Y A 0.1257
5 Q A -1.7797
6 N A -2.6149
7 R A -3.0925
8 P A -2.1708
9 G A -1.8589
10 G A -2.0853
11 Q A -1.9593
12 A A -1.0227
13 T A -1.1675
14 D A -1.3892
15 E A -1.6760
16 Y A -0.2245
17 G A -1.0105
18 N A -1.5721
19 P A -1.1307
20 I A -0.2945
21 Q A -1.1918
22 Q A -1.2477
23 Q A -1.3729
24 Y A -0.4512
25 D A -0.8807
26 E A -1.4707
27 Y A 0.0347
28 G A -0.7718
29 N A -1.2708
30 P A -1.0972
31 M A -0.4412
32 G A -0.8888
33 G A -0.9146
34 G A -0.7147
35 G A -0.4029
36 Y A 0.6093
37 G A -0.3283
38 T A -0.3983
39 G A -0.8618
40 G A -1.1894
41 G A -1.1645
42 G A -1.0997
43 G A -0.9281
44 A A -0.5966
45 T A -0.7891
46 G A -1.1597
47 G A -1.2705
48 Q A -1.5184
49 G A -0.7820
50 Y A 0.4246
51 G A -0.3843
52 T A -0.3312
53 G A -1.0118
54 G A -1.3405
55 Q A -1.4722
56 G A -0.7436
57 Y A 0.4083
58 G A -0.3721
59 S A -0.6737
60 G A -1.1901
61 G A -1.3674
62 Q A -1.5174
63 G A -0.7707
64 Y A 0.3928
65 G A -0.3748
66 T A -0.4834
67 G A -1.0806
68 G A -1.3404
69 Q A -1.5044
70 G A -0.7809
71 Y A 0.4275
72 G A -0.3203
73 T A -0.3377
74 G A -0.6564
75 T A -0.8370
76 G A -1.3188
77 T A -1.1702
78 E A -1.7581
79 G A -0.6491
80 F A 0.8914
81 G A -0.1435
82 T A -0.2602
83 G A -0.7338
84 G A -1.2007
85 G A -1.4401
86 A A -1.5844
87 R A -2.7623
88 H A -2.7013
89 H A -2.5536
90 G A -2.4220
91 Q A -2.7710
92 E A -2.9226
93 Q A -2.0329
94 L A -0.7223
95 H A -1.9374
96 K A -2.9002
97 E A -3.0057
98 S A -1.9869
99 G A -1.4610
100 G A -0.8953
101 G A -0.2813
102 L A 0.9400
103 G A 0.2924
104 G A 0.4568
105 M A 1.0847
106 L A 0.8016
107 H A -1.0282
108 R A -1.9727
109 S A -1.5389
110 G A -1.4687
111 S A -1.0049
112 G A -0.8467
113 S A -0.6964
114 S A -0.6020
115 S A -0.7082
116 S A -1.1160
117 S A -1.9748
118 E A -3.4410
119 D A -3.9959
120 D A -3.8637
121 G A -2.8805
122 Q A -2.8460
123 G A -2.6809
124 G A -2.7749
125 R A -4.0108
126 R A -4.2868
127 K A -3.8356
128 K A -3.2071
129 G A -1.6563
130 I A 0.4103
131 T A -0.5433
132 Q A -2.1332
133 K A -1.9524
134 I A -0.3322
135 K A -2.4448
136 E A -3.2424
137 K A -2.3425
138 L A -0.5131
139 P A -1.1029
140 G A -1.7673
141 H A -2.8653
142 H A -2.9631
143 D A -3.3860
144 Q A -3.0127
145 S A -2.0594
146 G A -1.9238
147 Q A -1.9734
148 A A -1.2392
149 Q A -1.2898
150 A A -0.2441
151 M A 0.5851
152 G A -0.0851
153 G A -0.1308
154 M A 0.4871
155 G A -0.2188
156 S A -0.2878
157 G A -0.3522
158 Y A 0.0554
159 D A -1.4463
160 A A -0.8395
161 G A -0.7231
162 G A -0.3963
163 Y A 0.3649
164 G A -0.9553
165 G A -1.7725
166 E A -3.0241
167 H A -3.6586
168 H A -3.8551
169 E A -3.8747
170 K A -3.5995
171 K A -3.5205
172 G A -2.1242
173 M A -0.8946
174 M A -1.2470
175 D A -3.1690
176 K A -2.5441
177 I A -0.4352
178 K A -2.5567
179 E A -3.3648
180 K A -2.4895
181 L A -0.4832
182 P A -0.9331
183 G A -1.4429
184 G A -1.8038
185 G A -1.7703
186 R A -2.2589
Download PDB file
View in 3Dmol