Project name: AlaVal_R1

Status: done

Started: 2026-08-20 09:24:36
Chain sequence(s) A: QVQLQESGPGLVKPSQTLSLTATVSGGSISSGDYYWSWIRQPPGCKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYVARVSIFGVGTFDYWGQGTLVTVSSAAGGGGSGGGGSGGGGSDIVMTQSPATLSLSPGERATLSARASQSVSSYLAWYQQKPGCQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYVHQYGSTPLTFGGGTKAEIKA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:38)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/2ff821fbadc91f6/tmp/folded.pdb                (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:11)
Show buried residues

Minimal score value
-2.6857
Maximal score value
2.1069
Average score
-0.5276
Total score value
-130.8516

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 Q A -1.5782
2 V A -1.1906
3 Q A -1.8917
4 L A 0.0000
5 Q A -1.6092
6 E A 0.0000
7 S A -0.5488
8 G A -0.2956
9 P A 0.1219
10 G A 0.5392
11 L A 1.0543
12 V A 0.0000
13 K A -1.8397
14 P A -1.3692
15 S A -1.4892
16 Q A -2.0598
17 T A -1.6718
18 L A 0.0000
19 S A -0.8687
20 L A 0.0000
21 T A -0.5371
22 A A 0.0000
23 T A -1.1271
24 V A 0.0000
25 S A -1.2758
26 G A -1.3084
27 G A -1.0251
28 S A -0.6941
29 I A 0.0000
30 S A -0.2466
31 S A -0.3010
32 G A -0.0635
33 D A 0.3588
34 Y A 0.8296
35 Y A 0.7441
36 W A 0.0000
37 S A 0.0000
38 W A 0.0000
39 I A 0.0000
40 R A -0.3139
41 Q A 0.0000
42 P A -0.6683
43 P A -0.6034
44 G A -1.1187
45 C A -1.2998
46 K A -2.0316
47 G A -1.2139
48 L A 0.0000
49 E A -0.7862
50 W A 0.0000
51 I A 0.0000
52 G A 0.0000
53 Y A 0.1780
54 I A 0.0000
55 Y A 0.3963
56 Y A 0.3910
57 S A -0.0867
58 G A -0.2122
59 S A -0.2309
60 T A -0.1821
61 D A -0.6652
62 Y A -0.6806
63 N A -0.9176
64 P A -1.0786
65 S A -0.8764
66 L A 0.0000
67 K A -2.0935
68 S A -1.4622
69 R A -1.7232
70 V A 0.0000
71 T A -1.0443
72 M A 0.0000
73 S A -0.3106
74 V A -0.3426
75 D A -1.1643
76 T A -1.0218
77 S A -1.3280
78 K A -2.1490
79 N A -1.4017
80 Q A -1.1966
81 F A 0.0000
82 S A -0.4347
83 L A 0.0000
84 K A -1.3250
85 V A 0.0000
86 N A -1.9626
87 S A -1.6583
88 V A 0.0000
89 T A -0.7128
90 A A -0.2447
91 A A -0.0216
92 D A 0.0000
93 T A 0.3673
94 A A 0.0000
95 V A 0.4081
96 Y A 0.0000
97 Y A 0.0000
98 V A 0.0000
99 A A 0.0000
100 R A 0.0000
101 V A 0.0000
102 S A 0.9091
103 I A 1.7242
104 F A 2.1069
105 G A 0.7991
106 V A 0.7059
107 G A 0.5409
108 T A 0.0000
109 F A 0.0000
110 D A -0.6292
111 Y A -0.5400
112 W A -0.7840
113 G A 0.0000
114 Q A -1.5469
115 G A 0.0000
116 T A 0.1546
117 L A 1.4350
118 V A 0.0000
119 T A 0.4861
120 V A 0.0000
121 S A -0.3731
122 S A -0.6365
123 A A -0.6313
124 A A -0.3545
125 G A -0.8363
126 G A -1.0708
127 G A -1.1222
128 G A -1.1715
129 S A -1.0169
130 G A -1.1829
131 G A -1.1971
132 G A -1.1904
133 G A -1.1781
134 S A -1.0270
135 G A -1.1315
136 G A -1.1689
137 G A -1.2303
138 G A -1.1873
139 S A -0.9811
140 D A -0.9844
141 I A -0.1772
142 V A 0.9579
143 M A 0.0000
144 T A -0.5771
145 Q A -0.6506
146 S A -0.7222
147 P A -0.3559
148 A A -0.3822
149 T A -0.5285
150 L A -0.2606
151 S A -0.3806
152 L A -0.6553
153 S A -0.9759
154 P A -1.4800
155 G A -1.8104
156 E A -2.3808
157 R A -2.6857
158 A A 0.0000
159 T A -0.5553
160 L A 0.0000
161 S A -0.8723
162 A A 0.0000
163 R A -2.3348
164 A A 0.0000
165 S A -0.8883
166 Q A -1.5965
167 S A -1.2063
168 V A 0.0000
169 S A -0.4242
170 S A -0.2106
171 Y A 0.8242
172 L A 0.0000
173 A A 0.0000
174 W A 0.0000
175 Y A 0.0000
176 Q A 0.0000
177 Q A 0.0000
178 K A -1.4937
179 P A -1.0247
180 G A -1.0595
181 C A -1.2344
182 Q A -1.8206
183 A A -1.2767
184 P A 0.0000
185 R A -1.5183
186 L A -0.7450
187 L A 0.0000
188 I A 0.0000
189 Y A -0.5099
190 D A -0.6326
191 A A 0.0000
192 S A -1.1563
193 N A -1.8106
194 R A -1.6497
195 A A -1.0704
196 T A -0.6378
197 G A -0.6343
198 I A 0.0000
199 P A -0.4298
200 A A -0.3778
201 R A -0.7506
202 F A 0.0000
203 S A -0.7494
204 G A 0.0000
205 S A -0.8584
206 G A -1.1166
207 S A -0.9382
208 G A -1.0460
209 T A -1.7583
210 D A -2.1804
211 F A 0.0000
212 T A -0.7703
213 L A 0.0000
214 T A -0.5900
215 I A 0.0000
216 S A -1.3729
217 S A -1.7544
218 L A 0.0000
219 E A -2.2484
220 P A -1.4036
221 E A -2.1079
222 D A 0.0000
223 F A -0.6823
224 A A 0.0000
225 V A -0.6416
226 Y A 0.0000
227 Y A 0.0000
228 V A 0.0000
229 H A 0.0000
230 Q A 0.0000
231 Y A 0.3188
232 G A 0.0748
233 S A -0.2124
234 T A -0.3941
235 P A -0.4141
236 L A 0.0000
237 T A 0.1634
238 F A 0.2743
239 G A 0.0000
240 G A -0.8073
241 G A -0.7859
242 T A 0.0000
243 K A -1.1958
244 A A 0.0000
245 E A -0.5273
246 I A 0.7673
247 K A -0.9016
248 A A -0.3545
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4955 4.9523 View CSV PDB
4.5 -0.5161 4.9508 View CSV PDB
5.0 -0.5401 4.9466 View CSV PDB
5.5 -0.5618 4.9361 View CSV PDB
6.0 -0.5748 4.9165 View CSV PDB
6.5 -0.5747 4.8891 View CSV PDB
7.0 -0.5619 4.8575 View CSV PDB
7.5 -0.5408 4.8244 View CSV PDB
8.0 -0.515 4.7908 View CSV PDB
8.5 -0.4859 4.757 View CSV PDB
9.0 -0.4539 4.7233 View CSV PDB