Project name: c46h2 [mutate: LK11A, YR32A, VE11B, YR54B, YR101B]

Status: done

Started: 2026-08-20 06:10:41
Chain sequence(s) A: DIVITQSPASLSLSQEEKVTITCRASESVEFYGTNLIQWYQQKPGQAPKLLIYGASNVESGVPSRFSGSGSGTDFTFTISSLEPEDVAVYYCQQSRKVPWTFGQGTKLEIK
B: EVQLVQSGAVVVKPGASVKVSCKASGYTFTDYYMNWVRQAPGAGLDWMGFINPYTDYINYNQNFKDRVTLTVDKSTSTAYMELSSLRAGDIAVYYCARRTYSDGTYYFDFWGQGTLVTVSS
input PDB
Selected Chain(s) A,B
Distance of aggregation 5 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Mutated residues YR32A,YR101B,LK11A,YR54B,VE11B
Energy difference between WT (input) and mutated protein (by FoldX) 2.76139 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:00:39)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:20)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3232cc15be36d15/tmp/folded.pdb                (00:01:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:26)
Show buried residues

Minimal score value
-2.143
Maximal score value
1.7728
Average score
-0.3193
Total score value
-74.07

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 D A -1.7894
2 I A 0.0000
3 V A 1.7728
4 I A 0.0000
5 T A -0.0709
6 Q A 0.0000
7 S A -0.1852
8 P A -0.1125
9 A A 0.0052
10 S A -0.3426
11 K A -0.3729 mutated: LK11A
12 S A -0.3375
13 L A 0.2310
14 S A -0.4118
15 Q A -1.0256
16 E A -2.1430
17 E A -1.6669
18 K A -1.9015
19 V A 0.0000
20 T A -0.0440
21 I A 0.0000
22 T A -0.0378
23 C A 0.0000
24 R A -1.9378
25 A A 0.0000
26 S A -0.5475
27 E A -1.8737
28 S A -0.4304
29 V A 0.0000
30 E A -1.1286
31 F A 0.1618
32 R A -1.7947 mutated: YR32A
33 G A -0.8092
34 T A -0.1197
35 N A -0.3201
36 L A 0.0000
37 I A 0.0000
38 Q A 0.0000
39 W A 0.0000
40 Y A 0.0000
41 Q A 0.0000
42 Q A 0.0000
43 K A -0.6847
44 P A -0.4573
45 G A -0.7358
46 Q A -1.2829
47 A A -0.2122
48 P A 0.0000
49 K A -1.3033
50 L A 0.0000
51 L A 0.0000
52 I A 0.0000
53 Y A 0.1748
54 G A -0.0174
55 A A 0.0000
56 S A -0.2482
57 N A -0.2419
58 V A 0.6938
59 E A -0.2971
60 S A -0.3759
61 G A -0.4660
62 V A 0.1104
63 P A -0.1084
64 S A -0.2864
65 R A -0.3307
66 F A 0.0000
67 S A -0.1217
68 G A -0.1366
69 S A -0.2619
70 G A -0.2884
71 S A -0.2717
72 G A -0.1608
73 T A -0.1977
74 D A -1.0188
75 F A 0.0000
76 T A -0.0235
77 F A 0.0000
78 T A -0.0271
79 I A 0.0000
80 S A -0.3199
81 S A -0.3855
82 L A 0.0000
83 E A -0.8048
84 P A -0.7281
85 E A -1.8669
86 D A 0.0000
87 V A 0.5377
88 A A 0.0000
89 V A 0.2612
90 Y A 0.0000
91 Y A 0.0000
92 C A 0.0000
93 Q A 0.0000
94 Q A 0.0000
95 S A 0.0000
96 R A -0.8669
97 K A -1.7253
98 V A 0.0978
99 P A 0.0000
100 W A 0.0000
101 T A -0.0113
102 F A 0.0000
103 G A 0.0000
104 Q A -1.1983
105 G A 0.0000
106 T A 0.0000
107 K A -0.6233
108 L A 0.0000
109 E A -1.0810
110 I A -0.2610
111 K A -1.6714
1 E B -1.8313
2 V B -0.4324
3 Q B -1.1621
4 L B 0.0000
5 V B 1.2119
6 Q B 0.0000
7 S B -0.1580
8 G B -0.4687
9 A B 0.1768
10 V B 0.3257
11 E B -1.6544 mutated: VE11B
12 V B -0.4003
13 K B -1.6808
14 P B -0.5495
15 G B -0.5202
16 A B -0.0916
17 S B -0.1223
18 V B 0.0000
19 K B -1.6785
20 V B 0.0000
21 S B -0.0165
22 C B 0.0000
23 K B -1.0044
24 A B 0.0000
25 S B -0.2039
26 G B -0.6057
27 Y B 0.1089
28 T B -0.0325
29 F B 0.0000
30 T B -0.5464
31 D B -1.7342
32 Y B 0.0182
33 Y B 0.2589
34 M B 0.0000
35 N B 0.0000
36 W B 0.0000
37 V B 0.0000
38 R B -0.2634
39 Q B -0.1770
40 A B -0.0509
41 P B -0.3379
42 G B -0.5079
43 A B -0.0794
44 G B -0.1256
45 L B 0.0000
46 D B -0.8021
47 W B 0.0000
48 M B 0.0000
49 G B 0.0000
50 F B 0.0000
51 I B 0.0000
52 N B -0.1377
53 P B 0.0000
54 R B -1.8581 mutated: YR54B
55 T B -0.7363
56 D B -1.6134
57 Y B 0.7849
58 I B 0.6270
59 N B -0.1222
60 Y B 0.3073
61 N B 0.0000
62 Q B -1.0422
63 N B -1.3887
64 F B 0.0000
65 K B -2.0977
66 D B -2.1418
67 R B -0.5341
68 V B 0.0000
69 T B -0.0622
70 L B 0.0000
71 T B 0.0109
72 V B 0.0657
73 D B -0.9933
74 K B -1.6697
75 S B -0.4909
76 T B -0.0706
77 S B -0.2229
78 T B 0.0000
79 A B 0.0000
80 Y B 0.2102
81 M B 0.0000
82 E B -0.9813
83 L B 0.0000
84 S B -0.1378
85 S B -0.2718
86 L B 0.0000
87 R B -1.8332
88 A B -0.3698
89 G B -0.4555
90 D B 0.0000
91 I B 0.5510
92 A B 0.0000
93 V B 0.5110
94 Y B 0.0000
95 Y B 0.0000
96 C B 0.0000
97 A B 0.0000
98 R B 0.0000
99 R B -0.2572
100 T B -0.3960
101 R B -1.8082 mutated: YR101B
102 S B -0.7615
103 D B -1.8929
104 G B -0.7985
105 T B 0.0000
106 Y B 0.1903
107 Y B 0.0000
108 F B 0.0000
109 D B -0.2345
110 F B 0.6282
111 W B 0.2504
112 G B 0.0000
113 Q B -1.2105
114 G B -0.2883
115 T B 0.0000
116 L B 0.7978
117 V B 0.0000
118 T B -0.1729
119 V B 0.0000
120 S B -0.1291
121 S B -0.2295
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.3259 1.8221 View CSV PDB
4.5 -0.3495 1.8221 View CSV PDB
5.0 -0.3793 1.8221 View CSV PDB
5.5 -0.4096 1.8221 View CSV PDB
6.0 -0.4347 1.8221 View CSV PDB
6.5 -0.4499 1.8221 View CSV PDB
7.0 -0.4539 1.8221 View CSV PDB
7.5 -0.4497 1.8221 View CSV PDB
8.0 -0.4407 1.8221 View CSV PDB
8.5 -0.4287 1.8221 View CSV PDB
9.0 -0.4135 1.8221 View CSV PDB