Project name: HS_235

Status: done

Started: 2026-03-20 01:20:00
Chain sequence(s) A: EVQLVESGGGLVQPGGSLKLSCAASGFTFGSYGMSWVRQTPDKRLDLVATINSHGGNTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARDRYYEAYWGQGTLVTVSA
B: QIVLTQSPEIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKFWIYSTSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCHQRSSFPYTFGGGTKLEIKR
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode Yes
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       CABS:     Running CABS flex simulation                                                (00:03:32)
[INFO]       Analysis: Starting Aggrescan4D on model_8.pdb                                         (00:45:44)
[INFO]       Analysis: Starting Aggrescan4D on model_6.pdb                                         (00:45:46)
[INFO]       Analysis: Starting Aggrescan4D on model_11.pdb                                        (00:45:47)
[INFO]       Analysis: Starting Aggrescan4D on model_7.pdb                                         (00:45:48)
[INFO]       Analysis: Starting Aggrescan4D on model_3.pdb                                         (00:45:49)
[INFO]       Analysis: Starting Aggrescan4D on model_5.pdb                                         (00:45:50)
[INFO]       Analysis: Starting Aggrescan4D on model_1.pdb                                         (00:45:51)
[INFO]       Analysis: Starting Aggrescan4D on model_0.pdb                                         (00:45:52)
[INFO]       Analysis: Starting Aggrescan4D on model_2.pdb                                         (00:45:53)
[INFO]       Analysis: Starting Aggrescan4D on model_4.pdb                                         (00:45:55)
[INFO]       Analysis: Starting Aggrescan4D on model_10.pdb                                        (00:45:56)
[INFO]       Analysis: Starting Aggrescan4D on model_9.pdb                                         (00:45:57)
[INFO]       Analysis: Starting Aggrescan4D on input.pdb                                           (00:45:58)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:46:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:46:04)
Show buried residues

Minimal score value
-3.4733
Maximal score value
1.7281
Average score
-0.3527
Total score value
-78.6512

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -2.1614
2 V A -1.0491
3 Q A -1.0547
4 L A 0.0000
5 V A 1.1792
6 E A 0.2608
7 S A -0.3898
8 G A -0.7090
9 G A -0.2845
10 G A 0.1034
11 L A 1.0491
12 V A 0.0000
13 Q A -0.0722
14 P A -0.1769
15 G A -0.4865
16 G A -0.1697
17 S A -0.5128
18 L A 0.0000
19 K A -1.7257
20 L A 0.0000
21 S A -0.5428
22 C A 0.0000
23 A A -0.2271
24 A A 0.0000
25 S A -0.4372
26 G A -0.6027
27 F A 0.1871
28 T A -0.1805
29 F A -0.9092
30 G A -0.9321
31 S A -0.4796
32 Y A 0.0000
33 G A 0.0000
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A 0.0000
40 T A -1.0080
41 P A -1.4408
42 D A -2.5292
43 K A -2.1344
44 R A -1.8868
45 L A 0.0000
46 D A -0.7566
47 L A 0.0000
48 V A 0.0000
49 A A 0.0000
50 T A 0.0000
51 I A 0.0000
52 N A 0.0000
53 S A -1.3288
54 H A -1.7325
55 G A -1.5789
56 G A -1.5017
57 N A -1.4257
58 T A -0.1458
59 Y A 1.1516
60 Y A 0.9064
61 P A -0.1267
62 D A -0.5179
63 S A 0.0745
64 V A 1.5647
65 K A 0.0000
66 G A 0.4965
67 R A 0.3806
68 F A 0.4668
69 T A 0.4193
70 I A 0.0000
71 S A -0.6562
72 R A -1.7577
73 D A -2.3014
74 N A -2.5981
75 A A -1.8645
76 K A -2.6251
77 N A -1.9843
78 T A 0.0000
79 L A 0.0000
80 Y A -0.6573
81 L A 0.0000
82 Q A -0.6888
83 M A 0.0000
84 S A -0.0450
85 S A 0.0000
86 L A 1.2212
87 K A 0.0000
88 S A -0.5357
89 E A -1.1039
90 D A 0.0000
91 T A -0.1888
92 A A 0.0000
93 M A -0.0235
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A 0.0000
99 D A 0.0000
100 R A 0.0075
101 Y A 0.8376
102 Y A 0.0000
103 E A -0.2901
104 A A 0.0000
105 Y A 0.0000
106 W A 0.0000
107 G A 0.0000
108 Q A -0.1398
109 G A -0.1308
110 T A 0.0000
111 L A 0.6661
112 V A 0.0000
113 T A 0.3724
114 V A 0.0000
115 S A -0.1570
116 A A 0.1971
1 Q B -0.5567
2 I B 0.6796
3 V B 1.4779
4 L B 0.0000
5 T B 0.2407
6 Q B 0.0000
7 S B -0.3131
8 P B -0.3722
9 E B -0.0732
10 I B 1.1362
11 M B 0.0000
12 S B -1.1400
13 A B 0.0000
14 S B 0.0000
15 P B -2.5421
16 G B -1.7230
17 E B -2.4082
18 K B -2.4948
19 V B -1.0123
20 T B -0.3995
21 I B 0.0000
22 T B -0.0903
23 C B 0.0000
24 S B 0.0715
25 A B 0.0000
26 S B 0.7259
27 S B 0.6394
28 S B 0.7089
29 V B 1.7281
30 S B 1.2093
31 Y B 1.4783
32 M B 0.0000
33 H B 0.0000
34 W B 0.0000
35 F B 0.0000
36 Q B 0.0000
37 Q B 0.0000
38 K B -1.4516
39 P B -1.5025
40 G B -1.2931
41 T B -1.1466
42 S B -0.8399
43 P B 0.0000
44 K B -0.7833
45 F B 0.0000
46 W B 0.0000
47 I B 0.0000
48 Y B 0.0000
49 S B -0.1275
50 T B -0.1282
51 S B -0.5729
52 N B -1.1793
53 L B -0.1940
54 A B 0.0000
55 S B -0.5681
56 G B -0.6272
57 V B 0.0726
58 P B -0.2664
59 A B -0.0359
60 R B 0.0000
61 F B 0.2433
62 S B -0.1733
63 G B -0.6413
64 S B -0.6071
65 G B -0.1325
66 S B -0.0361
67 G B 0.3829
68 T B 0.5320
69 S B 0.3230
70 Y B 0.2709
71 S B -0.0982
72 L B 0.0000
73 T B -0.0775
74 I B -0.3730
75 S B -1.3957
76 R B -2.7381
77 M B 0.0000
78 E B -3.4733
79 A B -1.9435
80 E B 0.0000
81 D B -2.6778
82 A B -1.5992
83 A B 0.0000
84 T B 0.0000
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 H B 0.0000
89 Q B 0.0000
90 R B 0.0000
91 S B 0.1516
92 S B -0.1472
93 F B -0.0419
94 P B 0.2040
95 Y B 0.0000
96 T B 0.0000
97 F B 0.0000
98 G B 0.0000
99 G B -1.0036
100 G B -0.5446
101 T B 0.0000
102 K B -0.4460
103 L B 0.0000
104 E B -1.6110
105 I B -3.0251
106 K B -3.4590
107 R B -3.4170
Download PDB file
View in 3Dmol

CABS-flex predictions of flexibility of input structure

In dynamic mode, A4D analysis is performed on the set of models reflecting fluctuations of the input structure (predicted by CABS-flex method, models are numbered from 0 to 11) and the input model. Their A4D scores are provided below in the table.
The right panel presents comparison of the most aggregation prone model (with the highest A4D score, -0.3527 in this case) with the input model (the most aggregation prone model in blue, input in red) and RMSF plot which shows the extent of residue fluctuations in Angstroms (predicted by CABS-flex).

Model
Average A4D Score
model_0 -0.3527 View CSV PDB
model_1 -0.3666 View CSV PDB
model_6 -0.4188 View CSV PDB
model_8 -0.4377 View CSV PDB
CABS_average -0.44 View CSV PDB
model_4 -0.4425 View CSV PDB
model_10 -0.4429 View CSV PDB
model_7 -0.4487 View CSV PDB
model_5 -0.4527 View CSV PDB
model_3 -0.4558 View CSV PDB
model_11 -0.4603 View CSV PDB
model_9 -0.4742 View CSV PDB
model_2 -0.5269 View CSV PDB
input -0.6003 View CSV PDB