Project name: 342173214602b5c

Status: done

Started: 2026-04-29 10:14:04
Chain sequence(s) A: MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETCLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTPNLTYIDPDALKELPLLKFLGIFNTGLKMFPPLTKVYSTDIFFILEITDNPYMTSIPRNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARNTWTLNHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:07:40)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/342173214602b5c/tmp/folded.pdb                (00:07:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:12:49)
Show buried residues

Minimal score value
-3.6391
Maximal score value
3.8074
Average score
-0.5639
Total score value
-150.5545

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.1234
2 R A -1.6795
3 P A -1.2923
4 A A -0.8188
5 D A -0.9704
6 L A 1.2979
7 L A 1.9272
8 Q A 1.1721
9 L A 3.1521
10 V A 3.8074
11 L A 3.6577
12 L A 3.5166
13 L A 2.5714
14 D A -0.0496
15 L A 0.4601
16 P A -1.0131
17 R A -2.2720
18 D A -1.9031
19 L A -0.1700
20 G A -0.5489
21 G A -0.5560
22 M A 0.3663
23 G A -0.6226
24 C A -0.6379
25 S A -0.4731
26 S A -0.7778
27 P A -1.2191
28 P A -1.5850
29 C A 0.0000
30 E A -2.3416
31 C A -1.6598
32 H A -2.4518
33 Q A -3.0212
34 E A -3.6391
35 E A -3.3738
36 D A -2.6274
37 F A -2.0180
38 R A -2.3986
39 V A 0.0000
40 T A 0.0000
41 C A 0.0000
42 K A -2.5836
43 D A -3.1042
44 I A 0.0000
45 Q A -2.7593
46 R A -2.7435
47 I A -0.9605
48 P A -0.7997
49 S A -0.5877
50 L A 0.0000
51 P A 0.0000
52 P A -0.6376
53 S A -0.7054
54 T A 0.0000
55 Q A -1.4711
56 T A 0.0000
57 L A 0.0000
58 K A -1.0674
59 L A 0.0000
60 I A -1.0055
61 E A -1.5287
62 T A 0.0000
63 C A -1.3625
64 L A 0.0000
65 R A -2.1376
66 T A -1.5461
67 I A 0.0000
68 P A -1.0635
69 S A -0.9107
70 H A -1.3496
71 A A -0.9400
72 F A 0.0000
73 S A -1.3853
74 N A -1.6993
75 L A 0.0000
76 P A -1.4654
77 N A -1.4548
78 I A 0.0000
79 S A -1.2147
80 R A -1.2695
81 I A 0.0000
82 Y A -0.1734
83 V A 0.0000
84 S A -0.1928
85 I A 0.4137
86 D A 0.0000
87 V A 1.0400
88 T A -0.2717
89 L A 0.0000
90 Q A -1.4026
91 Q A -1.1657
92 L A 0.0000
93 E A -1.1256
94 S A -0.9316
95 H A -1.1495
96 S A 0.0000
97 F A 0.0000
98 Y A -1.1539
99 N A -1.9947
100 L A 0.0000
101 S A -1.3778
102 K A -1.8624
103 V A 0.0000
104 T A -0.7145
105 H A -0.6619
106 I A 0.0000
107 E A -0.5599
108 I A 0.0000
109 R A -1.0689
110 N A -0.9059
111 T A 0.0000
112 P A -0.5799
113 N A -1.1733
114 L A 0.0000
115 T A -0.5667
116 Y A -0.1786
117 I A 0.0000
118 D A -0.5788
119 P A -0.6346
120 D A -0.9481
121 A A 0.0000
122 L A 0.0000
123 K A -1.1727
124 E A -1.3821
125 L A 0.0000
126 P A -0.4456
127 L A 0.2270
128 L A 0.0000
129 K A 0.0738
130 F A -0.0019
131 L A 0.0000
132 G A 0.0000
133 I A 0.0000
134 F A 0.0000
135 N A -1.4180
136 T A 0.0000
137 G A 0.0000
138 L A 0.0000
139 K A -0.9724
140 M A -0.0026
141 F A 0.0000
142 P A 0.0000
143 P A -0.3866
144 L A 0.0000
145 T A -0.6894
146 K A -0.7924
147 V A 0.0000
148 Y A -0.0395
149 S A 0.0000
150 T A 0.2085
151 D A 0.7009
152 I A 1.7542
153 F A 1.0385
154 F A 0.0000
155 I A 0.3489
156 L A 0.0000
157 E A -0.2265
158 I A 0.0000
159 T A 0.0000
160 D A -1.5148
161 N A 0.0000
162 P A -0.3811
163 Y A 0.2099
164 M A 0.0000
165 T A 0.0701
166 S A -0.2648
167 I A 0.0000
168 P A -1.2157
169 R A -2.3222
170 N A -1.7261
171 A A 0.0000
172 F A 0.0000
173 Q A -1.4220
174 G A -0.8203
175 L A 0.0000
176 C A 0.0000
177 N A -1.2556
178 E A -0.6576
179 T A -0.3611
180 L A 0.0000
181 T A 0.0000
182 L A 0.0000
183 K A -0.3987
184 L A 0.0000
185 Y A -1.0255
186 N A -1.8235
187 N A 0.0000
188 G A 0.0000
189 F A 0.0000
190 T A 0.4465
191 S A 0.4736
192 V A 0.0000
193 Q A -1.4798
194 G A -1.5319
195 Y A -1.0986
196 A A 0.0000
197 F A 0.0000
198 N A -0.9055
199 G A -0.5955
200 T A 0.0000
201 K A -1.0796
202 L A 0.0000
203 D A -1.0465
204 A A 0.0000
205 V A 0.0000
206 Y A -0.0594
207 L A 0.0000
208 N A -1.4861
209 K A -2.2771
210 N A 0.0000
211 K A -1.5021
212 Y A 0.4470
213 L A 0.0000
214 T A 0.8624
215 V A 1.4546
216 I A 0.0000
217 D A -1.1771
218 K A -2.2599
219 D A -1.8097
220 A A 0.0000
221 F A 0.0000
222 G A -0.7535
223 G A -0.4455
224 V A 0.3338
225 Y A 0.6807
226 S A -0.4102
227 G A -0.9829
228 P A 0.0000
229 S A -1.3418
230 L A -0.4744
231 L A 0.0000
232 D A 0.0000
233 V A 0.0000
234 S A 0.0000
235 Q A -1.8598
236 T A 0.0000
237 S A 0.1062
238 V A 0.0000
239 T A 0.3349
240 A A -0.1421
241 L A -0.1324
242 P A 0.0000
243 S A -1.6927
244 K A -2.6399
245 G A 0.0000
246 L A -1.4807
247 E A -2.7366
248 H A -2.3033
249 L A -1.6087
250 K A -2.1974
251 E A -1.0717
252 L A 0.2151
253 I A 0.0215
254 A A -0.7224
255 R A -2.2270
256 N A -1.9511
257 T A 0.0000
258 W A 0.2627
259 T A 0.0269
260 L A -0.5278
261 N A -1.5846
262 H A -2.5798
263 H A -2.5484
264 H A -2.7911
265 H A -2.6190
266 H A -2.4504
267 H A -1.8089
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.5742 4.6369 View CSV PDB
4.5 -0.6152 4.5308 View CSV PDB
5.0 -0.6645 4.4133 View CSV PDB
5.5 -0.7095 4.2987 View CSV PDB
6.0 -0.7367 4.2369 View CSV PDB
6.5 -0.7395 4.175 View CSV PDB
7.0 -0.7236 4.118 View CSV PDB
7.5 -0.6996 4.118 View CSV PDB
8.0 -0.6724 4.118 View CSV PDB
8.5 -0.6416 4.118 View CSV PDB
9.0 -0.6058 4.118 View CSV PDB