Project name: 3489c268f6dec7a

Status: done

Started: 2026-06-01 11:27:05
Chain sequence(s) A: SALDQVKSRVQKVLEKVLSQIASDPNLSAQQRFLLSHAVYEDISHVQDTISTLDVSSANQVVDATAQQLEALLKQASAAPSALDQVKSRVQKVLEKVLSQIASDPNLSAQQRFLLSHAVYEDISHVQDTISTLDVSSANQVVDATAQQLEALLKQASAAPSALDQVKSRVQKVLEKVLSQIASDPNLSAQQRFLLSHAVYEDISHVQDTISTLDVSSANQVVDATAQQLEALLKQASAQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:17)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/3489c268f6dec7a/tmp/folded.pdb                (00:06:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:41)
Show buried residues

Minimal score value
-3.4487
Maximal score value
1.4985
Average score
-1.1469
Total score value
-274.11

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 S A -0.9769
2 A A -1.0378
3 L A -1.2608
4 D A -2.5946
5 Q A -2.4956
6 V A 0.0000
7 K A -2.6728
8 S A -2.4488
9 R A -2.6541
10 V A 0.0000
11 Q A -2.6958
12 K A -3.1834
13 V A -2.2688
14 L A -1.7750
15 E A -3.0651
16 K A -2.5881
17 V A 0.0000
18 L A -1.1817
19 S A -1.2981
20 Q A -1.7257
21 I A 0.0000
22 A A -0.4302
23 S A -0.9094
24 D A -1.2258
25 P A -1.1643
26 N A -1.6776
27 L A 0.0000
28 S A -0.7740
29 A A -0.3774
30 Q A -0.5502
31 Q A -0.4275
32 R A -0.2391
33 F A 1.4985
34 L A 1.4480
35 L A 0.0000
36 S A 0.2102
37 H A -0.1993
38 A A -0.2842
39 V A 0.0000
40 Y A -0.2222
41 E A -2.1173
42 D A -2.1831
43 I A 0.0000
44 S A -1.7537
45 H A -2.3968
46 V A 0.0000
47 Q A -2.2545
48 D A -2.5028
49 T A -1.2368
50 I A 0.0000
51 S A -0.9894
52 T A -0.6505
53 L A -0.5016
54 D A -1.3493
55 V A -0.7249
56 S A -0.7127
57 S A -0.9134
58 A A 0.0000
59 N A -1.3255
60 Q A -1.3554
61 V A -0.5323
62 V A 0.0000
63 D A -1.5726
64 A A -1.3412
65 T A -1.4842
66 A A -1.8232
67 Q A -2.1448
68 Q A -2.3132
69 L A 0.0000
70 E A -2.4415
71 A A -1.9134
72 L A -1.3036
73 L A 0.0000
74 K A -2.5158
75 Q A -2.0228
76 A A -1.5038
77 S A -1.6328
78 A A -1.2052
79 A A -0.8579
80 P A -1.0587
81 S A -0.6315
82 A A -0.5392
83 L A -0.6452
84 D A -1.1724
85 Q A -1.5266
86 V A 0.0000
87 K A -2.2244
88 S A -2.0086
89 R A -2.5846
90 V A 0.0000
91 Q A -2.9852
92 K A -3.4487
93 V A 0.0000
94 L A -2.0101
95 E A -3.3464
96 K A -3.0112
97 V A 0.0000
98 L A -1.3041
99 S A -1.5041
100 Q A -1.9720
101 I A 0.0000
102 A A -0.5454
103 S A -0.9674
104 D A -1.2666
105 P A -1.1806
106 N A -1.7516
107 L A 0.0000
108 S A -0.8363
109 A A -0.4642
110 Q A -0.6709
111 Q A -0.5603
112 R A -0.3644
113 F A 1.2988
114 L A 1.4059
115 L A 0.0000
116 S A 0.3127
117 H A -0.1280
118 A A -0.2805
119 V A 0.0000
120 Y A -0.1344
121 E A -2.2245
122 D A -2.3027
123 I A 0.0000
124 S A -1.8010
125 H A -2.4695
126 V A 0.0000
127 Q A -2.4265
128 D A -2.5572
129 T A -1.2703
130 I A 0.0000
131 S A -1.0703
132 T A -0.6635
133 L A -0.5324
134 D A -1.3863
135 V A -0.5734
136 S A -0.7445
137 S A -1.0117
138 A A 0.0000
139 N A -1.5286
140 Q A -1.6144
141 V A -0.7701
142 V A 0.0000
143 D A -2.3131
144 A A -1.6651
145 T A -1.7302
146 A A -2.1263
147 Q A -2.3017
148 Q A -2.3822
149 L A 0.0000
150 E A -2.3807
151 A A -1.8579
152 L A -1.2442
153 L A 0.0000
154 K A -2.4784
155 Q A -1.9990
156 A A -1.4989
157 S A -1.6756
158 A A -1.2396
159 A A -0.8947
160 P A -1.1228
161 S A -0.7010
162 A A -0.6282
163 L A -0.7281
164 D A -1.4550
165 Q A -1.5481
166 V A 0.0000
167 K A -2.0159
168 S A -1.8827
169 R A -2.3978
170 V A 0.0000
171 Q A -2.8040
172 K A -3.2228
173 V A -2.3487
174 L A -1.8856
175 E A -3.1879
176 K A -2.6991
177 V A 0.0000
178 L A -1.2829
179 S A -1.5302
180 Q A -2.0189
181 I A 0.0000
182 A A -0.5823
183 S A -1.0265
184 D A -1.3369
185 P A -1.1928
186 N A -1.8345
187 L A 0.0000
188 S A -0.8015
189 A A -0.4515
190 Q A -0.6537
191 Q A -0.4792
192 R A -0.3736
193 F A 1.1916
194 L A 1.3098
195 L A 0.0000
196 S A 0.0819
197 H A -0.2661
198 A A -0.3693
199 V A 0.0000
200 Y A -0.3199
201 E A -2.3144
202 D A -2.3150
203 I A 0.0000
204 S A -1.8736
205 H A -2.5004
206 V A 0.0000
207 Q A -2.4199
208 D A -2.5737
209 T A -1.2798
210 I A 0.0000
211 S A -1.1056
212 T A -0.6341
213 L A -0.5205
214 D A -1.3850
215 V A -0.6359
216 S A -0.7398
217 S A -0.9698
218 A A 0.0000
219 N A -1.3996
220 Q A -1.5267
221 V A -0.7013
222 V A 0.0000
223 D A -2.0476
224 A A -1.5368
225 T A -1.6032
226 A A -1.9408
227 Q A -2.1993
228 Q A -2.3112
229 L A 0.0000
230 E A -2.2439
231 A A -1.7673
232 L A -1.1907
233 L A 0.0000
234 K A -2.6055
235 Q A -2.2264
236 A A 0.0000
237 S A -1.7981
238 A A -1.6254
239 Q A -1.8902
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.9534 3.2828 View CSV PDB
4.5 -1.0396 3.2848 View CSV PDB
5.0 -1.1395 3.2906 View CSV PDB
5.5 -1.2341 3.307 View CSV PDB
6.0 -1.3075 3.3448 View CSV PDB
6.5 -1.3537 3.4067 View CSV PDB
7.0 -1.376 3.4719 View CSV PDB
7.5 -1.3822 3.5155 View CSV PDB
8.0 -1.3766 3.5356 View CSV PDB
8.5 -1.3583 3.543 View CSV PDB
9.0 -1.3245 3.5455 View CSV PDB