Project name: 361126e75d264e9

Status: done

Started: 2026-05-29 16:58:35
Chain sequence(s) A: MSALDQVKSRVQKVLEKVLSQIASDPNLSAQQRFLVSHAVYEDISHVQDTISTLDVSSANQVVDATAQQLEALLKQASAQSALDQVKSRVQKVLEKVLSQIASDPNLSAQQRFLVSHAVYEDISHVQDTISTLDVSSANQVVDATAQQLEALLKQASAQSALDQVKSRVQKVLEKVLSQIASDPNLSAQQRFLVSHAVYEDISHVQDTISTLDVSSANQVVDATAQQLEALLKQASAQPHHHHHHRHC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       PDB-Info: The input structure is partially or entirely disordered. Average score is   
                       recommended for pH analysis.                                                (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:05:12)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/361126e75d264e9/tmp/folded.pdb                (00:05:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:44)
Show buried residues

Minimal score value
-3.2979
Maximal score value
1.6492
Average score
-1.1904
Total score value
-295.2287

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.5375
2 S A -0.1846
3 A A -0.4037
4 L A -0.5562
5 D A -1.4587
6 Q A -1.5460
7 V A 0.0000
8 K A -2.3201
9 S A -2.0205
10 R A -2.3738
11 V A 0.0000
12 Q A -2.7798
13 K A -3.2874
14 V A -2.5367
15 L A 0.0000
16 E A -3.2979
17 K A -3.0275
18 V A 0.0000
19 L A -1.2237
20 S A -1.3818
21 Q A -1.9078
22 I A 0.0000
23 A A -0.4006
24 S A -0.7970
25 D A -1.2223
26 P A -0.9424
27 N A -1.6012
28 L A 0.0000
29 S A -0.5847
30 A A -0.2393
31 Q A -0.4977
32 Q A -0.2039
33 R A 0.0379
34 F A 1.6036
35 L A 1.3439
36 V A 0.0000
37 S A 0.4593
38 H A 0.0233
39 A A -0.0553
40 V A 0.0000
41 Y A -0.1077
42 E A -1.6355
43 D A -1.7337
44 I A 0.0000
45 S A -1.5827
46 H A -2.2536
47 V A 0.0000
48 Q A -2.2754
49 D A -2.4426
50 T A -1.2530
51 I A 0.0000
52 S A -1.0308
53 T A -0.6544
54 L A -0.4877
55 D A -1.3383
56 V A -0.5942
57 S A -0.7706
58 S A -0.9948
59 A A 0.0000
60 N A -1.4988
61 Q A -1.6635
62 V A -0.7055
63 V A 0.0000
64 D A -2.3699
65 A A -1.6208
66 T A -1.6178
67 A A -2.0561
68 Q A -2.3679
69 Q A -2.4077
70 L A 0.0000
71 E A -2.4277
72 A A -1.8708
73 L A -1.3096
74 L A 0.0000
75 K A -2.7636
76 Q A -2.2723
77 A A -1.3992
78 S A -1.7562
79 A A -1.8433
80 Q A -2.0383
81 S A -1.7232
82 A A 0.0000
83 L A -1.6754
84 D A -2.4512
85 Q A -2.5236
86 V A 0.0000
87 K A -2.5385
88 S A -2.2638
89 R A -2.5682
90 V A 0.0000
91 Q A -2.8934
92 K A -3.2242
93 V A -2.3495
94 L A -1.8090
95 E A -3.1187
96 K A -2.6287
97 V A 0.0000
98 L A -1.0828
99 S A -1.2440
100 Q A -1.7356
101 I A 0.0000
102 A A -0.3653
103 S A -0.7963
104 D A -1.2339
105 P A -0.9509
106 N A -1.6036
107 L A 0.0000
108 S A -0.5700
109 A A -0.2209
110 Q A -0.4553
111 Q A -0.1490
112 R A 0.0750
113 F A 1.6492
114 L A 1.4590
115 V A 0.0000
116 S A 0.3900
117 H A -0.1680
118 A A -0.2782
119 V A 0.0000
120 Y A -0.4236
121 E A -2.2882
122 D A -2.1167
123 I A 0.0000
124 S A -1.8840
125 H A -2.4999
126 V A 0.0000
127 Q A -2.5542
128 D A -2.5486
129 T A -1.3256
130 I A 0.0000
131 S A -1.1324
132 T A -0.6916
133 L A -0.5695
134 D A -1.4433
135 V A -0.9388
136 S A -0.8035
137 S A -1.0429
138 A A 0.0000
139 N A -1.6383
140 Q A -1.7126
141 V A -0.7692
142 V A 0.0000
143 D A -2.4499
144 A A -1.6627
145 T A -1.6186
146 A A -1.9386
147 Q A -2.2860
148 Q A -2.3342
149 L A 0.0000
150 E A -2.1003
151 A A -1.7289
152 L A -1.1870
153 L A 0.0000
154 K A -2.6710
155 Q A -2.2081
156 A A -1.4202
157 S A -1.7363
158 A A -1.7901
159 Q A -1.9834
160 S A 0.0000
161 A A -1.6502
162 L A -1.6355
163 D A -2.4471
164 Q A -2.5334
165 V A 0.0000
166 K A -2.5479
167 S A -2.3743
168 R A -2.7307
169 V A 0.0000
170 Q A -2.8504
171 K A -3.2706
172 V A 0.0000
173 L A 0.0000
174 E A -3.0798
175 K A -2.4105
176 V A 0.0000
177 L A -1.1081
178 S A -1.1851
179 Q A -1.4999
180 I A 0.0000
181 A A -0.3145
182 S A -0.8451
183 D A -1.3232
184 P A -1.1364
185 N A -1.9264
186 L A 0.0000
187 S A -0.7722
188 A A -0.2365
189 Q A -0.4577
190 Q A -0.2259
191 R A 0.0104
192 F A 1.6067
193 L A 1.3631
194 V A 0.0000
195 S A 0.2891
196 H A -0.2916
197 A A -0.3533
198 V A 0.0000
199 Y A -0.5791
200 E A -2.3258
201 D A -2.1122
202 I A 0.0000
203 S A -1.8511
204 H A -2.4517
205 V A 0.0000
206 Q A -2.3711
207 D A -2.4709
208 T A -1.2798
209 I A 0.0000
210 S A -1.0932
211 T A -0.6741
212 L A -0.5627
213 D A -1.4260
214 V A -0.8891
215 S A -0.7869
216 S A -1.0376
217 A A 0.0000
218 N A -1.6275
219 Q A -1.6944
220 V A -0.8562
221 V A 0.0000
222 D A -2.4620
223 A A -1.6438
224 T A -1.6319
225 A A -2.0718
226 Q A -2.2639
227 Q A -2.3328
228 L A 0.0000
229 E A -2.0951
230 A A -1.7401
231 L A -1.2144
232 L A 0.0000
233 K A -2.5689
234 Q A -2.1842
235 A A 0.0000
236 S A -1.9290
237 A A -1.6283
238 Q A -2.0465
239 P A -1.9030
240 H A -2.5447
241 H A -2.6456
242 H A -2.8298
243 H A -3.0502
244 H A -3.2297
245 H A -3.0715
246 R A -3.0808
247 H A -2.0084
248 C A -0.4906
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is partially or entirely disordered. Average score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -1.1471 3.5521 View CSV PDB
4.5 -1.2295 3.5617 View CSV PDB
5.0 -1.3206 3.5865 View CSV PDB
5.5 -1.3993 3.6356 View CSV PDB
6.0 -1.4499 3.7006 View CSV PDB
6.5 -1.4738 3.7548 View CSV PDB
7.0 -1.4837 3.7845 View CSV PDB
7.5 -1.4876 3.7965 View CSV PDB
8.0 -1.4854 3.8006 View CSV PDB
8.5 -1.4724 3.802 View CSV PDB
9.0 -1.444 3.8024 View CSV PDB