Project name: 36438961a32da98

Status: done

Started: 2026-03-11 21:54:19
Chain sequence(s) A: PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:03)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:06:11)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/36438961a32da98/tmp/folded.pdb                (00:06:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:10)
Show buried residues

Minimal score value
-3.9158
Maximal score value
1.5174
Average score
-1.095
Total score value
-255.1362

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
54 P A -1.1809
55 C A -1.5144
56 Q A -2.1795
57 N A -2.3648
58 H A -2.1431
59 H A -2.2126
60 C A -1.6872
61 K A -2.5099
62 H A -2.1204
63 G A -1.2669
64 K A -1.3583
65 V A -0.6883
66 C A -0.9495
67 E A -1.4781
68 L A -1.4055
69 D A -2.3375
70 E A -3.1957
71 N A -2.9084
72 N A -2.7276
73 T A -1.6768
74 P A -1.2804
75 M A -0.3373
76 C A -0.1826
77 V A -0.1027
78 C A -0.8084
79 Q A -1.1828
80 D A -1.8967
81 P A -1.3608
82 T A -1.0218
83 S A -0.9603
84 C A 0.0000
85 P A -0.2052
86 A A -0.0925
87 P A 0.1356
88 I A 1.5174
89 G A 0.2143
90 E A -0.9218
91 F A 1.0559
92 E A 0.0175
93 K A -0.5762
94 V A 0.0000
95 C A 0.0000
96 S A 0.0000
97 N A -2.5040
98 D A -3.0942
99 N A -3.0654
100 K A -2.9860
101 T A -1.9896
102 F A -1.0380
103 D A -1.6946
104 S A -0.5759
105 S A -0.3123
106 C A -0.7678
107 H A -0.8541
108 F A 0.0000
109 F A -0.6297
110 A A 0.0000
111 T A -0.4518
112 K A -1.1582
113 C A 0.0000
114 T A -0.6231
115 L A -1.9304
116 E A -2.6792
117 G A -2.1984
118 T A -2.7090
119 K A -3.6352
120 K A -3.7079
121 G A 0.0000
122 H A -3.6105
123 K A -3.6981
124 L A 0.0000
125 H A -1.4993
126 L A 0.0000
127 D A -0.9088
128 Y A 0.0000
129 I A 1.3554
130 G A 0.0886
131 P A -0.9502
132 C A -1.3254
133 K A -0.9644
134 Y A 0.7441
135 I A 0.8873
136 P A 0.4703
137 P A 0.0694
138 C A -0.0334
139 L A 0.2898
140 D A -1.3878
141 S A -0.7573
142 E A -0.6381
143 L A -0.6426
144 T A -0.4953
145 E A -0.8584
146 F A 0.0000
147 P A -0.0742
148 L A -0.1011
149 R A -0.4203
150 M A 0.0000
151 R A 0.0000
152 D A 0.0000
153 W A 0.3270
154 L A 0.0000
155 K A 0.0000
156 N A -0.2406
157 V A 0.2283
158 L A 0.0000
159 V A 0.0000
160 T A -1.0433
161 L A -1.1840
162 Y A -1.9352
163 E A -2.9601
164 R A -3.2534
165 D A -3.2331
166 E A -3.9158
167 D A -3.5574
168 N A -3.2870
169 N A -2.7738
170 L A -1.5735
171 L A 0.0000
172 T A -2.1251
173 E A -3.2321
174 K A -2.8501
175 Q A -1.7421
176 K A -2.2281
177 L A -1.7076
178 R A -2.3438
179 V A 0.0000
180 K A -2.7738
181 K A -3.0210
182 I A 0.0000
183 H A -3.0615
184 E A -3.6096
185 N A -3.5497
186 E A -3.6715
187 K A -3.6432
188 R A -3.0665
189 L A -1.8866
190 E A -2.5910
191 A A -1.4241
192 G A -1.7710
193 D A -2.2152
194 H A -1.4361
195 P A -0.9523
196 V A -0.9666
197 E A -1.8923
198 L A -1.0320
199 L A 0.0000
200 A A -1.8645
201 R A -3.0141
202 D A 0.0000
203 F A -2.0183
204 E A -3.2703
205 K A -3.4095
206 N A 0.0000
207 Y A -1.8112
208 N A -1.6469
209 M A 0.0000
210 Y A 0.0000
211 I A -0.4561
212 F A 0.0000
213 P A 0.0000
214 V A 0.0000
215 H A 0.0000
216 W A -0.1515
217 Q A 0.0000
218 F A 0.0000
219 G A -0.3035
220 Q A -0.8858
221 L A 0.0000
222 D A 0.0000
223 Q A -0.8155
224 H A -1.1491
225 P A -0.6967
226 I A 0.7723
227 D A -0.8922
228 G A -0.2759
229 Y A 0.1755
230 L A 0.0000
231 S A 0.0000
232 H A -0.9293
233 T A 0.0000
234 E A 0.0000
235 L A 0.0000
236 A A 0.0000
237 P A 0.0919
238 L A 0.0000
239 R A 0.0000
240 A A 0.5276
241 P A 0.4105
242 L A 1.3960
243 I A 0.0000
244 P A -0.0058
245 M A 0.1817
246 E A -0.1304
247 H A -0.1586
248 C A 0.0000
249 T A 0.0000
250 T A -1.1506
251 R A -1.7171
252 F A 0.0000
253 F A 0.0000
254 E A -2.5505
255 T A -0.9965
256 C A 0.0000
257 D A 0.0000
258 L A -0.6574
259 D A -2.2702
260 N A -3.0792
261 D A -3.0922
262 K A -3.1641
263 Y A -1.0043
264 I A 0.0000
265 A A -0.6721
266 L A -1.0040
267 D A -2.4421
268 E A -1.0260
269 W A 0.0000
270 A A 0.0000
271 G A -1.8408
272 C A -0.4824
273 F A 0.0000
274 G A -0.9948
275 I A 0.0000
276 K A -2.7293
277 Q A -3.2803
278 K A -3.1310
279 D A -2.3679
280 I A -2.3210
281 D A -2.3845
282 K A -2.3112
283 D A -2.0336
284 L A -1.1308
285 V A 0.0000
286 I A 1.1815
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.7509 4.5368 View CSV PDB
4.5 -0.86 4.3107 View CSV PDB
5.0 -0.9916 4.0089 View CSV PDB
5.5 -1.12 3.6795 View CSV PDB
6.0 -1.218 3.3726 View CSV PDB
6.5 -1.2697 3.1881 View CSV PDB
7.0 -1.2786 3.1033 View CSV PDB
7.5 -1.2594 3.054 View CSV PDB
8.0 -1.2235 3.0407 View CSV PDB
8.5 -1.1735 3.0404 View CSV PDB
9.0 -1.1081 3.0403 View CSV PDB