Project name: f05 original antibody

Status: done

Started: 2026-03-17 06:26:26
Chain sequence(s) A: EIVLTQSPATLSLSPGERVILSCRVSQSVSSYLAWYQQKPGQAPRLLIYDTSNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYAMSWVRQAPGKGLEWVSSISASGATTFYADPVKGRFTISRDNSKKTLYLQMNSLRAEDTAVYYCAKDQDFDILTGYLNWFDPWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage Used: no changes made
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       PDB:      Running AlphaCutter                                                         (00:00:03)
[INFO]       PDB:      AlphaCutter did not cut any residues. The original structure will be used   
                       for analysis.                                                               (00:00:19)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:20)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:20)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:04:28)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/37365de9eb10843/tmp/folded.pdb                (00:04:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:08:55)
Show buried residues

Minimal score value
-3.0103
Maximal score value
1.7677
Average score
-0.6378
Total score value
-157.5374

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.7387
2 I A 0.0000
3 V A 0.7821
4 L A 0.0000
5 T A -0.5598
6 Q A 0.0000
7 S A -0.4161
8 P A -0.0526
9 A A -0.2751
10 T A -0.3984
11 L A -0.1309
12 S A -0.8771
13 L A -1.1027
14 S A -1.4372
15 P A -1.6136
16 G A -1.7559
17 E A -2.2854
18 R A -2.1021
19 V A 0.0000
20 I A 1.3849
21 L A 0.0000
22 S A -0.4139
23 C A 0.0000
24 R A -2.2515
25 V A 0.0000
26 S A -0.8677
27 Q A -1.5372
28 S A -1.3609
29 V A 0.0000
30 S A -0.6988
31 S A -0.3947
32 Y A -0.3895
33 L A 0.0000
34 A A 0.0000
35 W A 0.0000
36 Y A 0.0000
37 Q A 0.0000
38 Q A 0.0000
39 K A -1.7680
40 P A -1.1532
41 G A -1.5003
42 Q A -2.2456
43 A A -1.6143
44 P A 0.0000
45 R A -2.1523
46 L A 0.0000
47 L A 0.0000
48 I A 0.0000
49 Y A 0.0000
50 D A 0.0000
51 T A 0.0000
52 S A -0.8620
53 N A -1.1695
54 R A -1.5500
55 A A 0.0000
56 T A -0.7534
57 G A -0.6377
58 I A -0.6099
59 P A -0.3486
60 A A -0.3408
61 R A -0.6413
62 F A 0.0000
63 S A -0.3851
64 G A 0.0000
65 S A -0.6716
66 G A -1.0431
67 S A -0.7908
68 G A -1.0510
69 T A -1.6243
70 D A -2.1361
71 F A 0.0000
72 T A -0.2999
73 L A 0.0000
74 T A 0.1952
75 I A 0.0000
76 S A -1.0348
77 S A -1.7253
78 L A 0.0000
79 E A -2.0844
80 P A -1.8470
81 E A -2.6228
82 D A 0.0000
83 F A -0.9773
84 A A 0.0000
85 V A -0.3148
86 Y A 0.0000
87 Y A 0.0000
88 C A 0.0000
89 Q A 0.0000
90 Q A 0.0000
91 R A 0.0000
92 R A -1.6902
93 N A -1.7123
94 W A -0.6592
95 P A -0.8473
96 L A 0.0000
97 T A 0.0000
98 F A 0.1990
99 G A 0.0000
100 G A -0.7091
101 G A -0.6404
102 T A 0.0000
103 K A -0.8226
104 V A 0.0000
105 E A -1.3036
106 I A -1.0430
107 K A -2.0455
108 G A -1.5827
109 G A -1.4282
110 G A -1.3100
111 G A -1.4086
112 S A -1.0536
113 G A -1.5527
114 G A -1.5704
115 G A -1.7885
116 G A -1.6410
117 S A -1.2503
118 G A -1.4503
119 G A -1.2601
120 G A -1.4770
121 G A -1.6756
122 S A -1.7485
123 E A -2.4205
124 V A -1.5589
125 Q A -1.7146
126 L A 0.0000
127 V A 0.0548
128 E A 0.0000
129 S A -0.3669
130 G A -0.6903
131 G A 0.1671
132 G A 0.8015
133 L A 1.3265
134 V A 0.0000
135 Q A -1.5323
136 P A -1.9215
137 G A -1.6985
138 G A -1.2111
139 S A -1.4850
140 L A -0.8926
141 R A -1.8571
142 L A 0.0000
143 S A -0.4616
144 C A 0.0000
145 A A -0.5089
146 A A 0.0000
147 S A -0.9557
148 G A -1.2211
149 F A -0.7495
150 T A -0.6873
151 F A 0.0000
152 S A -1.5904
153 R A -1.8895
154 Y A -0.8377
155 A A 0.0000
156 M A 0.0000
157 S A 0.0000
158 W A 0.0000
159 V A 0.0000
160 R A 0.0000
161 Q A -0.6369
162 A A -1.0484
163 P A -0.8363
164 G A -1.4490
165 K A -2.2677
166 G A -1.3687
167 L A 0.0000
168 E A -0.9400
169 W A 0.0000
170 V A 0.0000
171 S A 0.0000
172 S A 0.0000
173 I A 0.0000
174 S A -0.1475
175 A A -0.7048
176 S A -0.7737
177 G A -0.4268
178 A A -0.1338
179 T A -0.0089
180 T A 0.2056
181 F A 0.2273
182 Y A -0.5746
183 A A 0.0000
184 D A -2.6006
185 P A -1.8717
186 V A 0.0000
187 K A -2.5796
188 G A -1.8726
189 R A -1.8083
190 F A 0.0000
191 T A -0.8974
192 I A 0.0000
193 S A -0.4036
194 R A -0.9924
195 D A -1.5653
196 N A -1.9471
197 S A -1.6527
198 K A -2.4994
199 K A -2.0466
200 T A -1.2181
201 L A 0.0000
202 Y A -0.5066
203 L A 0.0000
204 Q A -1.3762
205 M A 0.0000
206 N A -2.0785
207 S A -1.6620
208 L A 0.0000
209 R A -3.0103
210 A A -2.0577
211 E A -2.4728
212 D A 0.0000
213 T A -0.5240
214 A A 0.0000
215 V A 0.7314
216 Y A 0.0000
217 Y A 0.0000
218 C A 0.0000
219 A A 0.0000
220 K A 0.0000
221 D A 0.0000
222 Q A 0.0000
223 D A -0.4994
224 F A 1.0869
225 D A 0.0035
226 I A 1.7677
227 L A 1.2595
228 T A 0.9871
229 G A 0.9995
230 Y A 1.2670
231 L A 0.0000
232 N A 0.0000
233 W A 0.0000
234 F A 0.0000
235 D A -1.1171
236 P A -1.2013
237 W A 0.0000
238 G A 0.0000
239 Q A -1.3378
240 G A 0.0000
241 T A 0.4592
242 L A 1.5171
243 V A 0.0000
244 T A 0.1907
245 V A 0.0000
246 S A -0.9094
247 S A -0.5887
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.4929 4.9996 View CSV PDB
4.5 -0.5243 4.6816 View CSV PDB
5.0 -0.563 4.3355 View CSV PDB
5.5 -0.6027 3.9793 View CSV PDB
6.0 -0.6356 3.62 View CSV PDB
6.5 -0.6557 3.2607 View CSV PDB
7.0 -0.662 2.9072 View CSV PDB
7.5 -0.6576 2.6734 View CSV PDB
8.0 -0.6464 2.4535 View CSV PDB
8.5 -0.6301 2.2672 View CSV PDB
9.0 -0.6091 2.2275 View CSV PDB