Project name: RFA45_protenix

Status: done

Started: 2026-06-14 16:00:28
Chain sequence(s) A: EVQLVESGGGLEQPGGSLRLSCAGSGFTFSSQGFGWVRQAPGKGLEWVSSISPDGSGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCATLKRMPGYTGGGYYGDVWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISCRSTYLTDAVGWYLQKSGQSPQLLIYGRSQRGSGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYCMQGWGAPGTFGQGTKLEIKRTV
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations Yes
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       PDB-Info: The input structure is globular. Max score is recommended for pH analysis.  (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:01)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:57)
[INFO]       agg3D:    Running pKa-ANI on                                                          
                       /STORAGE/DATA/lcbio/aggreskan/377c33743a8d020/tmp/folded.pdb                (00:01:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:25)
Show buried residues

Minimal score value
-3.3114
Maximal score value
1.3492
Average score
-0.6583
Total score value
-155.3531

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 E A -1.6139
2 V A -0.2285
3 Q A -0.6369
4 L A 0.0000
5 V A 0.6046
6 E A 0.0000
7 S A -0.5123
8 G A -0.9912
9 G A -0.5047
10 G A 0.1108
11 L A 0.8906
12 E A -0.6237
13 Q A -1.6062
14 P A -1.7447
15 G A -1.6079
16 G A -1.2191
17 S A -1.4456
18 L A -1.2052
19 R A -2.3023
20 L A 0.0000
21 S A -0.4750
22 C A 0.0000
23 A A -0.2990
24 G A 0.0000
25 S A -0.5747
26 G A -0.7305
27 F A -0.1392
28 T A -0.1482
29 F A 0.0000
30 S A -1.3104
31 S A -0.8072
32 Q A -0.7588
33 G A 0.0000
34 F A 0.0000
35 G A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A 0.0000
39 Q A -0.9058
40 A A -1.2938
41 P A -1.0366
42 G A -1.4733
43 K A -2.3506
44 G A -1.5075
45 L A 0.0000
46 E A -1.2099
47 W A 0.0000
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A -0.7996
53 P A -1.3603
54 D A -2.2804
55 G A -1.4280
56 S A -0.9341
57 G A -0.4609
58 T A 0.1656
59 Y A 0.2435
60 Y A -0.5726
61 A A -1.2867
62 D A -2.5614
63 S A -1.7153
64 V A 0.0000
65 K A -2.4823
66 G A -1.8266
67 R A -1.7201
68 F A 0.0000
69 T A -0.9433
70 I A 0.0000
71 S A -0.6728
72 R A -1.3166
73 D A -1.8602
74 N A -2.1207
75 S A -1.6891
76 K A -2.4933
77 N A -1.9484
78 T A -1.1710
79 L A 0.0000
80 Y A -0.6275
81 L A 0.0000
82 Q A -1.6109
83 M A 0.0000
84 N A -2.1151
85 S A -1.5323
86 L A 0.0000
87 R A -2.3650
88 A A -1.7707
89 E A -2.2125
90 D A 0.0000
91 T A -0.7302
92 A A 0.0000
93 V A -0.0321
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 T A 0.0000
99 L A -0.5027
100 K A -1.4120
101 R A -2.0843
102 M A -1.0602
103 P A -0.7340
104 G A -0.2687
105 Y A 0.9968
106 T A 0.1527
107 G A -0.2903
108 G A -0.7077
109 G A -0.6119
110 Y A -0.3545
111 Y A 0.0000
112 G A 0.0000
113 D A -0.6511
114 V A 0.0687
115 W A 0.0000
116 G A 0.0000
117 Q A -1.3444
118 G A 0.0000
119 T A -0.2576
120 T A -0.0790
121 V A 0.0000
122 T A -0.1831
123 V A 0.0000
124 S A -0.8586
125 S A -0.6529
126 A A -0.2489
127 S A -0.2610
1 D B -1.4447
2 I B 0.4310
3 V B 0.6487
4 M B 0.0000
5 T B -0.5620
6 Q B 0.0000
7 S B -0.2103
8 P B 0.2193
9 L B 0.9952
10 S B 0.2434
11 L B -0.0906
12 P B -1.1197
13 V B 0.0000
14 T B -1.7480
15 P B -1.8677
16 G B -1.9540
17 E B -2.3055
18 P B -2.1310
19 A B 0.0000
20 S B -0.7919
21 I B 0.0000
22 S B -0.9997
23 C B 0.0000
24 R B -1.9479
25 S B 0.0000
26 T B 0.2401
27 Y B 1.0949
28 L B 1.3492
29 T B 0.0000
30 D B -0.9104
31 A B 0.0000
32 V B 0.0000
33 G B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 L B 0.0000
37 Q B 0.0000
38 K B -1.2653
39 S B -0.8828
40 G B -1.4520
41 Q B -2.0471
42 S B -1.3190
43 P B 0.0000
44 Q B -1.0160
45 L B 0.0000
46 L B 0.0000
47 I B 0.0000
48 Y B -0.8923
49 G B -1.2054
50 R B -1.3828
51 S B -1.1915
52 Q B -1.3627
53 R B -1.5988
54 G B -0.9142
55 S B -0.8053
56 G B -0.8486
57 V B -1.0202
58 P B -1.3048
59 D B -2.4127
60 R B -2.2421
61 F B 0.0000
62 S B -1.3960
63 G B 0.0000
64 S B -1.0955
65 G B -1.3459
66 S B -1.1533
67 G B -0.4556
68 T B -0.9677
69 D B -2.4137
70 F B 0.0000
71 T B -1.2274
72 L B 0.0000
73 K B -1.6643
74 I B 0.0000
75 S B -2.3807
76 R B -3.3114
77 V B 0.0000
78 E B -2.6023
79 A B -1.4333
80 E B -2.1416
81 D B 0.0000
82 V B -0.5025
83 G B 0.0000
84 F B 0.3040
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 M B 0.0000
89 Q B 0.0000
90 G B 0.0000
91 W B 1.0456
92 G B 0.2100
93 A B 0.3797
94 P B -0.0011
95 G B 0.0896
96 T B -0.1364
97 F B 0.0000
98 G B 0.0000
99 Q B -0.9219
100 G B 0.0000
101 T B 0.0000
102 K B -0.2337
103 L B 0.0000
104 E B -1.1425
105 I B -1.4571
106 K B -2.4345
107 R B -2.1778
108 T B -0.4721
109 V B 0.9438
Download PDB file
View in 3Dmol

Calculations for various pH values

This page contains details and comparisons for all models calculated at different pH points.
Please find suggestions on interpreting the results below. More details can be found in the Tutorial.
The input structure is globular. Max score is recommended for pH analysis.

pH
Average A4D Score
Max A4D Score
4.0 -0.6116 3.1791 View CSV PDB
4.5 -0.6583 3.1579 View CSV PDB
5.0 -0.713 3.1331 View CSV PDB
5.5 -0.7683 3.1067 View CSV PDB
6.0 -0.8155 3.0799 View CSV PDB
6.5 -0.8471 3.053 View CSV PDB
7.0 -0.8611 3.0261 View CSV PDB
7.5 -0.8619 2.9994 View CSV PDB
8.0 -0.854 2.9737 View CSV PDB
8.5 -0.8388 2.9504 View CSV PDB
9.0 -0.8163 2.9321 View CSV PDB