Project name: 3829542bb04a56b

Status: done

Started: 2026-08-18 11:22:03
Chain sequence(s) A: MKLLKVAAIAAIVFSGSALAGVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQTDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGGGNGAAVDQTASNSSVNVTQVGFGNNATAHQY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
pH calculations No
alphaCutter usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimization                                          (00:00:02)
[INFO]       Analysis: Starting Aggrescan4D on folded.pdb                                          (00:01:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)
Show buried residues

Minimal score value
-3.6683
Maximal score value
2.6472
Average score
-0.43
Total score value
-64.9344

The table below lists A4D score for protein residues. Residues with A4D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan4D score mutation
1 M A 0.8375
2 K A -0.2311
3 L A 1.4275
4 L A 1.2296
5 K A -0.5015
6 V A 0.1609
7 A A -0.3527
8 A A 0.0836
9 I A 0.1779
10 A A 1.1812
11 A A 0.0000
12 I A 2.6472
13 V A 0.0000
14 F A 2.3186
15 S A 0.0000
16 G A -0.0592
17 S A -0.0401
18 A A 0.5502
19 L A 1.6421
20 A A 1.5142
21 G A 1.8821
22 V A 1.8698
23 V A 1.1160
24 P A 0.0728
25 Q A -0.7359
26 Y A 0.4515
27 G A -0.7742
28 G A -0.7531
29 G A -1.1187
30 G A -1.6806
31 N A -2.1874
32 H A -2.0108
33 G A -1.6310
34 G A -1.2250
35 G A -1.4424
36 G A -1.7607
37 N A -2.3365
38 N A -2.4013
39 S A -2.1070
40 G A -1.9322
41 P A -2.7982
42 N A -3.3088
43 S A 0.0000
44 E A -2.8059
45 L A 0.0000
46 N A -0.0788
47 I A 0.0000
48 Y A 0.8715
49 Q A 0.0000
50 Y A 0.0335
51 G A -0.3366
52 G A -0.3432
53 G A -0.3591
54 N A 0.0000
55 S A 0.6486
56 A A 0.0000
57 L A 1.3430
58 A A 0.0000
59 L A 0.9549
60 Q A 0.0000
61 T A -0.4867
62 D A -1.9692
63 A A 0.0000
64 R A -3.6612
65 N A -3.6683
66 S A 0.0000
67 D A -2.8355
68 L A 0.0000
69 T A -0.8487
70 I A 0.0000
71 T A -0.3782
72 Q A 0.0000
73 H A -0.9180
74 G A -0.5603
75 G A -0.2769
76 G A -0.2701
77 N A 0.0000
78 G A -0.2243
79 A A 0.0000
80 D A -0.9872
81 V A 0.0000
82 G A 0.0000
83 Q A 0.0000
84 G A -1.2960
85 S A 0.0000
86 D A -2.8171
87 D A -3.0569
88 S A 0.0000
89 S A -2.0332
90 I A 0.0000
91 D A -1.3896
92 L A 0.0000
93 T A 0.0000
94 Q A 0.0000
95 R A -1.0498
96 G A -0.0244
97 F A 1.1780
98 G A 0.1496
99 N A 0.0000
100 S A -0.5964
101 A A 0.0000
102 T A -0.7642
103 L A 0.0000
104 D A -0.8912
105 Q A 0.0000
106 W A -0.9601
107 N A -1.5149
108 G A 0.0000
109 K A -2.9180
110 N A -2.9146
111 S A 0.0000
112 E A -2.6973
113 M A 0.0000
114 T A -1.2682
115 V A 0.0000
116 K A -0.6056
117 Q A 0.0000
118 F A 0.8424
119 G A 0.9026
120 G A 0.9820
121 G A 0.1845
122 N A 0.0000
123 G A -0.7471
124 A A 0.0000
125 A A -0.7498
126 V A 0.0000
127 D A -0.9745
128 Q A 0.0000
129 T A -0.6496
130 A A -0.8696
131 S A -1.8983
132 N A -2.4259
133 S A -1.4843
134 S A -1.5936
135 V A 0.0000
136 N A -1.7148
137 V A 0.0000
138 T A -0.0748
139 Q A 0.0000
140 V A 1.8745
141 G A 1.4115
142 F A 1.8805
143 G A 0.0980
144 N A -0.4109
145 N A -1.4244
146 A A -0.7615
147 T A -0.6476
148 A A -0.9085
149 H A -1.1363
150 Q A -0.4226
151 Y A 0.6360
Download PDB file
View in 3Dmol